KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2597Help
Entry
blr2597           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_tail_APC
Motif
Other DBs
NCBI-GeneID: 1054003
NCBI-ProteinID: NP_769237
RhizoBase: blr2597
UniProt: Q89S15
Position
2839680..2840096
Genome map
AA seq 138 aa AA seqDB search
MPEGEISLGDFFGDFFAPMEPPSILHATQPAIAGSIGMNDLSRRASSDVHAHLATMEPVN
TGTFDMGKVVFLYRSLAYRNAAADMLRKARKLPRGAERSAARRYAMALRDLAQTEAWLEG
RIAHEPRPVRRMKVAASG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaggagagatcagccttggcgactttttcggcgactttttcgcgcccatggaa
ccgccctcgatcttgcatgcaacgcagccggcgattgcgggttccatcggcatgaacgat
ttgtcacgtcgggcttcatccgacgttcatgcccaccttgcgaccatggagcccgtcaac
acgggaacattcgatatgggtaaggttgtctttctctatcgctcgctggcctatcgaaac
gcggccgccgacatgctgcgcaaggcgcgcaagctgccgcgcggtgccgagcgaagcgcg
gcccgccgctatgcgatggcgttacgcgatctcgcgcaaacggaagcttggctcgaaggg
cgcatcgcccatgaacctcggccggtgcggcgcatgaaggtcgccgcgtcgggttaa

DBGET integrated database retrieval system