KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2603Help
Entry
blr2603           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRC DUF2171
Motif
Other DBs
NCBI-GeneID: 1049170
NCBI-ProteinID: NP_769243
RhizoBase: blr2603
UniProt: Q89S09
Position
2850997..2851371
Genome map
AA seq 124 aa AA seqDB search
MLNQRELDRSEMGRLIGSDRVEGTSVYGADRNKIGSIERVMIDKISGKVSYAVLGFGGFL
GVGNDHYPLPWQSLKYDTDLGGYVTGITAKELQGAPKYGEQSDWNWGDDAAVRGINSYYG
VPFA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatcaacgcgaactggaccgcagcgaaatgggccggttgatcggcagcgacagg
gtcgagggaacgtcggtctatggcgcggatcgcaacaagatcggttcgatcgagcgggtg
atgatcgacaagatcagtggcaaggtgtcctacgcggtgctcggcttcggtggatttttg
ggcgtcggcaatgaccactatcccttgccgtggcagtccctgaagtacgacaccgatctc
ggtggctacgtgaccgggattacagccaaggagctgcaaggcgcgccgaaatatggtgag
cagagcgattggaactggggtgacgatgctgcggtgcgcggcatcaactcctactatggc
gttcccttcgcgtag

DBGET integrated database retrieval system