KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2605Help
Entry
blr2605           CDS       T00109                                 

Definition
(RefSeq) short chain dehydrogenase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR 3HCDH_N MlaE
Motif
Other DBs
NCBI-GeneID: 1049126
NCBI-ProteinID: NP_769245
RhizoBase: blr2605
UniProt: Q89S07
Position
2852303..2853040
Genome map
AA seq 245 aa AA seqDB search
MSKRNATAAVIGAGDFIGSEIAKKFAAEGFSIFAGRRNGDKLAPLVKDIEAAGGEIHARS
LDARKEEEVISFLDDADKHAPLEVCIFNVGANVNFPILDTTERVFRKVWEMACYSGFLAG
REAARLMLPRGGGKIFFTGATASLRGGSGFAAFASAKFGLRAVAQAMARELGPKNIHVAH
LIIDSGVDTEWVRQRRLEALGPNALDNPDLLMPPSAVADSYWQLYQQPKSAWTFEMEIRP
FGEKW
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaagcgaaacgcgacagctgccgtcatcggggccggcgatttcatcggctccgaa
atcgcgaagaaattcgccgccgaaggtttttcgatcttcgccggccgccgcaacggcgac
aagctcgcgccgctggtgaaggacatcgaggcggccggtggcgaaatccacgcgcgctcg
ctcgatgcgcgcaaggaggaagaggtcatctccttcctcgatgacgccgacaagcacgca
ccgctggaagtttgcatcttcaacgtcggcgccaacgtcaatttcccgatactcgacacc
accgagcgcgtgttccgtaaagtctgggagatggcctgctattccggcttcctggcaggc
cgggaagctgcgcggctgatgcttccgcgcggcggcggcaaaatcttcttcactggcgca
acggcctccttgcgtggcggcagcggctttgccgcgttcgccagcgcaaagtttggtctg
cgtgcggtggcgcaggcgatggcgcgcgagcttgggccgaagaacatccacgtcgcccat
ctcatcatcgattccggcgttgacaccgagtgggtgcggcagcgccggctcgaagcgctc
ggcccgaacgcgctcgacaatcccgacctgctgatgccgccgtcggccgtggccgattct
tattggcagctctaccagcagccgaagagcgcttggacattcgagatggagatccggccc
ttcggagagaaatggtga

DBGET integrated database retrieval system