KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2606Help
Entry
blr2606           CDS       T00109                                 

Definition
(RefSeq) 2-nitropropane dioxygenase
  KO
K00459  nitronate monooxygenase [EC:1.13.12.16]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    blr2606
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.16  nitronate monooxygenase
     blr2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO IMPDH FMN_dh His_biosynth
Motif
Other DBs
NCBI-GeneID: 1049137
NCBI-ProteinID: NP_769246
RhizoBase: blr2606
UniProt: Q89S06
Position
2853103..2854104
Genome map
AA seq 333 aa AA seqDB search
MKTAITELFGIEHPIIQGGMHFVGFAELAAAVSNAGGLGIITGLTQKTPELLAKEIARCR
DMTDKPFGVNLTFLPAFSAPPYPEYIAAIVEGGVKAVETAGRSPEQYMPALKAAGIKVIH
KCTSVRHSLKAERIGCDAVSVDGFECGGHPGEDDIPNMILLPRAAEELKIPFVASGGMAD
GRSLVAALSLGAAGMNMGTRFIATKEAPVHQNVKNALVAATELDTRLIMRSLRNTERVLK
NANVDRLLEIEREKGDKLTIDDIHDQVAGVYPRIMLDGQMDAGAWSCGMVAGLIHDIPSC
KELVDRIMSEAETIIRGRLMGFLDGTGATRKVA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccgcgatcaccgaactgttcggcatcgagcaccccatcatccagggcggcatg
catttcgtcggctttgccgagctggctgccgccgtctcgaatgccggcgggctcggcatc
atcaccggcctcacgcagaagacgccggagctgctggcgaaagagatcgcgcgctgccgc
gacatgaccgacaagccgttcggcgtgaatctcacgtttctgccggctttctcggcaccg
ccttatccggaatacatcgcggccattgtcgaaggcggcgtcaaggcggtggagactgcg
ggtcgcagcccggaacagtatatgccggcgcttaaggcggctggcatcaaggtgatccat
aaatgcacgtcagttcgccattccctgaaggccgagcggatcggctgcgatgccgtcagc
gtcgacggctttgagtgcggcggccatcccggcgaggacgacattccgaacatgatcctg
ctgccgcgcgcggcagaggaattgaagatcccgttcgttgcctccggcggcatggctgac
gggcgcagcctcgtcgcggcgctgtcgctgggcgcggccggcatgaacatgggcacgcgc
ttcattgcgaccaaggaagcgccggtgcatcagaacgtgaagaacgcgctggtcgccgcc
accgagctcgacacccgtctgatcatgcggagcttgcgcaacacagaacgcgtcctgaag
aacgccaatgtcgatcgtctgctcgagatcgagcgcgagaagggcgacaagctcaccatc
gacgacatccacgaccaggtcgcgggcgtctatcccaggatcatgctggacgggcagatg
gatgcgggcgcctggagctgcggcatggtcgcaggcctcatccacgacatcccctcctgc
aaggaactcgtcgatcgcatcatgagtgaggcggaaaccatcatccgcggccgcctgatg
gggttcctggacgggacgggcgcgacacgaaaggtcgcctga

DBGET integrated database retrieval system