KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2608Help
Entry
blr2608           CDS       T00109                                 

Definition
(RefSeq) alkaline phosphatase transmembrane protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Metallophos Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 1049113
NCBI-ProteinID: NP_769248
RhizoBase: blr2608
UniProt: Q89S04
Position
2854948..2856513
Genome map
AA seq 521 aa AA seqDB search
MATLRAPRAWTRRQFLVRSTSGLALAALAKPSISRAADRPQIAGGIQSGDVSDGSAVIWA
RADRAARMQVECSTVESFKTIVAAASGDTRPDADFTSKLLLSDLPPGQDIFYRVRFDDIA
TGIAGESRVGHFRTAPAAGQSISFLWSGDTAGQGWGIDISRGGYRSYRTMLDNRPDFFIH
SGDHIYADCTIPSEQKLPSGETWRNIVTEEKSEVARTLAQFRGNYKYNHLDAHFRDFHAN
VPMFAQWDDHEVTNDWSPSGSYDEAGYEDDGTPRLVARARRAFFDFMPIRDIGARQGRVY
RKIAYGPLLDVFMIDMRSFRDETWNKGADHRGWILGAEQLAWLKRELAASRATWKVIAAD
LPIGLISLDAVALGNGPPDRREHEIADLLGSIRRAGVRNVVWLTADMHYTAAHYYDPNRA
QFQDFEPFWEFVSGPLHAGTWGPGELDDTFGPVAMYQNGCSEAQGENLAPCFGLQFFGRV
DIDGASGVMTVTLKDVDNRDLWSVDIVPQSQARPAVVAQHS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgctccgcgccccgcgcgcatggacccggcggcaattcctggtccgctccacc
tccggcctcgccttggccgcgctcgcaaagccatccatcagccgtgccgccgaccgcccg
cagatcgccggcggcatccagtccggcgacgtctcggacggctccgccgtgatctgggcg
cgcgccgatcgggccgcgcgcatgcaggtggaatgctcgaccgtcgagagtttcaagacc
attgttgccgcggcctccggcgacacgcggccggacgccgacttcacctcgaagctgctg
ctgagcgatctgccgccggggcaggacatcttctatcgcgtccgcttcgatgacatcgcg
accggcatcgccggcgaaagccgcgtcggccatttccgcactgcgccggccgcagggcaa
tcgatctcgttcctgtggtccggcgacaccgcggggcagggctggggcatcgacatctcg
cgcggcggctatcgcagctatcgcaccatgctcgacaatcgccctgacttcttcattcac
tccggtgaccatatctacgccgactgcacgattccatccgagcagaagctgccgagcggc
gagacctggcgcaacatcgtcacggaggaaaaatcggaggtcgcgcgcacgctggcgcag
tttcgcggcaactacaaatacaatcatctcgatgcgcattttcgcgatttccacgcgaat
gtgccgatgttcgcgcagtgggacgatcacgaggtcaccaacgactggtcaccgtccggc
agctatgacgaggccggttatgaggacgacggcacgccgcgcctggtcgcgcgcgcccgc
cgcgccttcttcgacttcatgccgatccgcgacatcggcgcacggcaggggcgggtctat
cgcaagatcgcttacggtccgctgctcgacgtcttcatgatcgacatgcgcagttttcgg
gatgagacctggaacaagggcgccgaccatcgcggctggattctcggcgccgagcagctg
gcctggctgaagcgggagctggccgcctcgcgcgcgacctggaaggtgatcgccgccgac
ctgccgatcggcctgatcagtctcgatgcggtcgcgctcggcaatgggccgcctgataga
cgcgagcacgagatcgccgatctgctcggctccatcaggcgcgccggcgtgcgcaacgtc
gtctggctcaccgccgacatgcactacaccgccgcgcactactacgatcccaacagggcg
caattccaggacttcgaaccgttctgggagttcgtctccggcccgctgcatgccggcacc
tggggcccgggcgaactcgacgacacttttggtccggtcgcgatgtaccagaacggatgc
agcgaagcgcagggcgagaacctcgcgccctgcttcggattgcagttcttcggccgcgtc
gacatcgatggcgcgagcggcgtgatgaccgtgacgctgaaagacgtcgacaaccgcgac
ctctggtcggtcgacatcgtgccgcagtcgcaggcgcgcccggccgtggtcgcgcagcat
tcgtga

DBGET integrated database retrieval system