KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2611Help
Entry
blr2611           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_25
Motif
Other DBs
NCBI-GeneID: 1054071
NCBI-ProteinID: NP_769251
RhizoBase: blr2611
UniProt: Q89S01
Position
2858529..2858861
Genome map
AA seq 110 aa AA seqDB search
MRPAVSGVGWLLPKANVDRPMLNQVMDFAGEVLPGSCAVPPYSETAFLAELGDRLKSSRT
RCDLSRRELARRSGISERYIAQIEAGKGNVSIVLLLRLASAIHGSQPQAA
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggccgtatcgggggtaggatggctgctcccgaaggcgaacgtggatagacca
atgctgaatcaagtcatggattttgcgggcgaagtgctgccggggagctgtgccgtgccg
ccttattcggagaccgcgtttctggccgagctgggcgaccgcttgaagtcctcgcgcacg
cgctgcgacctctcgcgccgggagctggcccgccgctccgggatttccgagcgctatatc
gcccagatcgaggccggcaagggcaacgtctcgatcgtcctgttgctgcggctggcctcc
gcgatccacggcagccagccccaggcggcttga

DBGET integrated database retrieval system