KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2617Help
Entry
blr2617           CDS       T00109                                 

Definition
(RefSeq) metallo-beta-lactamase superfamily protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 1053749
NCBI-ProteinID: NP_769257
RhizoBase: blr2617
UniProt: Q89RZ5
Position
2865278..2866228
Genome map
AA seq 316 aa AA seqDB search
MGQQCTGSPMSDNDDVPFNRNFPLKAGVVEEVRPGVRRVLCNNPSPFTFSGTVSYIVGTG
NVAIIDPGPDDAAHATALLDAVRGETVSHIFVTHTHRDHSPNTARIKQATGAPVYAEGPH
RASRPRFESEKHNPESGVDRDFAPDIRIAHGDVVEGAGWRLEAVATPGHTANHLAFAWPE
RKFNFVGDHVMGWSTSIVAPPDGSMIDYMESLDCLAAREEDLYFSGHGPEIPDGPRFVRF
LIRHRKAREASILHRLAKGEADIPTMVRAIYIGIDPRLTTAAGYSVLAHLEDLVARGVVA
TDGDPVIGGTYRMAGA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtggggcagcagtgcacaggaagtcccatgtccgacaacgacgacgtcccgttcaaccgc
aactttccactcaaagccggcgtcgtcgaggaagtccgccccggcgtgcggcgcgtgctc
tgtaacaatccgagcccgttcaccttcagcggtacggtcagctacatcgtcggcacgggc
aacgtcgcgatcatcgatcccggtcctgatgatgcggcgcatgcgactgcgctgctcgat
gccgtgcgcggcgagacggtgagccacatcttcgtcacccacacccaccgcgaccattcg
ccgaacacggcgcggatcaagcaggcgaccggcgcgcctgtttatgccgagggcccgcac
cgcgcctcgcgcccgcgcttcgagagcgagaagcacaatccggaatccggcgtcgatcgc
gatttcgcgcccgatatcaggatcgcccatggcgacgtcgtcgagggcgcgggctggcgc
ctcgaggcggtggcgacgccgggtcataccgccaaccatctcgccttcgcctggcccgag
cgaaaattcaacttcgtcggtgaccacgtgatgggctggtcgacctcgatcgttgcgccg
cccgacgggtcgatgatcgactacatggaatcgctcgattgcttggccgcccgcgaggag
gatctctatttctcaggccatggccccgagataccggatggtccgcgcttcgtgcgtttc
ctgatccgccaccgcaaggcgcgcgaagcctctatcctgcatcgtctcgccaagggcgag
gccgacatcccgaccatggtgcgtgcgatctatatcggcatcgatccacggctgacgacg
gccgcgggctattccgtgctggcgcatctggaagatctggtcgcccgcggcgtggtggcg
acggatggcgatcccgtgattggcgggacataccggatggcgggagcctag

DBGET integrated database retrieval system