KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2620Help
Entry
blr2620           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Extensin-like_C
Motif
Other DBs
NCBI-GeneID: 1053283
NCBI-ProteinID: NP_769260
RhizoBase: blr2620
UniProt: Q89RZ2
Position
2868990..2870069
Genome map
AA seq 359 aa AA seqDB search
MSFSLPDFRRKWSCRGYMSAGAAMVTVALGLTLGLADRAEARKYAAPLDIFGFGTPRPRA
KVHSAKIPLPKPRPAEAPKAPDGAAPEADGKPSPDKPSPDKPAEAPPLPEKQVSACRLAL
TEEIAIAPSIPDIRGPGGCGGEDLVRLEAIVLPDKRKVAVKPAAILRCTMASAIADWVRK
DMVPLATSLGSTISDLDNFDSFECRGRNRIVGALLSEHGKANALDVRAVKLANGQSIGLT
DRTMSRDVRERVLHSVCARFSTVLGPGSDWYHEDHIHLDLAQRRNDYRICQWNVWDPLPQ
IAPLLPAERPEEAPPREVASKPEAKDGAGDEAAEKSPAPADKPAADKVQPSKPATKKRR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagttttagcctgccggactttcgccgcaaatggtcttgtcgcggctatatgtccgcc
ggcgcggcaatggttaccgtcgcgctggggctgacgcttgggctcgcggatcgggcggag
gcgcgaaaatatgctgcgccgctcgatatctttggctttggtacaccacggccgcgcgcg
aaggttcattccgccaagatcccgctaccgaaacctcgccccgcggaggcccccaaagca
ccggacggggccgcaccggaggccgacggcaagccttccccggacaagccttcccccgac
aagccggccgaggcgccgccgctgcccgagaagcaggtctcggcctgccggctcgcgctg
accgaggagatcgcaattgcaccctccatccccgatatccgcggccccggcggctgcggt
ggcgaggatctggtgcggctggaggccatcgtgctgccggacaagcgcaaggtggcggtc
aagccggcggcgatccttcgctgcaccatggcgtctgcgatagccgactgggtgcgcaag
gacatggtgccgctggctaccagtctcggctcgaccatcagcgatctcgacaatttcgat
agcttcgagtgccgcggccgcaatcgcatcgttggagcgttgctgtccgagcacggcaag
gccaacgccctcgacgtccgcgccgtcaagctcgccaacgggcagtcgattggcctcacc
gatcgcaccatgtcgcgtgacgtgcgcgagcgtgtgctgcattcggtgtgcgcgcgcttt
tccaccgtgctcggccctggctcggactggtaccacgaggaccatatccatctcgacctg
gcgcagcggcgcaacgactaccggatctgccagtggaacgtctgggatcccctgccgcag
atcgcgccgctgctgccggcggaacggcccgaggaggcgccgccgcgcgaggtcgcgtcc
aagcctgaggcaaaggatggggctggtgacgaggcggcggagaaatcccccgcgcctgcg
gacaagccggcggccgacaaggtccagccgtccaagccggcaacaaaaaagcgccggtaa

DBGET integrated database retrieval system