KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2629Help
Entry
blr2629           CDS       T00109                                 

Gene name
fabI
Definition
(RefSeq) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00061  Fatty acid biosynthesis
bja00780  Biotin metabolism
bja01100  Metabolic pathways
bja01130  Biosynthesis of antibiotics
bja01212  Fatty acid metabolism
Module
bja_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    blr2629 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    blr2629 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    blr2629 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bja01004]
    blr2629 (fabI)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     blr2629 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     blr2629 (fabI)
Lipid biosynthesis proteins [BR:bja01004]
 Fatty acid synthase
  Component type
   blr2629 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 1048940
NCBI-ProteinID: NP_769269
RhizoBase: blr2629
UniProt: Q89RY3
Position
2877570..2878385
Genome map
AA seq 271 aa AA seqDB search
MAQNSGLMQGKRGVVLGVANNRSIAWGIAKACHAAGAELAFTYQGDALKKRVEPLAAEIG
GLVLGHCDVTDAATIDAAFAVLKEKWGKIDFLVHAIAYGEQLDGRYVDTTQENFSKSMLI
SCYSFTAVAQRAEKLMTDGGSLITLSYYGAEKWMPHYNVMGVAKAALEASVRYLAADLGE
KNIRVNAISAGPIKTLAASGIGDFRYILKWNEHNAPLRRNVSTEDVGGSALYFLSDLSRG
VTGEVHHVDSGYHVLGMKRPDAPDISLGGKD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaattcaggtctgatgcaaggcaagcgcggggtggtcctcggcgttgccaac
aaccgctcgatcgcctggggtatcgccaaggcatgccacgcagcgggcgccgagctcgcc
ttcacctatcagggcgatgcgctgaagaagcgcgtcgagccgctcgccgccgagatcggc
ggactcgtgctcggccattgcgacgtcaccgacgctgcgacaatcgacgccgccttcgcg
gtgctgaaggagaagtggggcaagatcgacttcctggtgcacgcgatcgcctatggcgag
cagctcgacggccgctacgtcgacaccacgcaggagaacttctccaagtcgatgctgatt
tcctgctactcgttcaccgccgtggcacagcgcgccgagaagctgatgaccgacggcggt
tcgctcatcacgctctcctattacggcgcggagaagtggatgccgcattacaacgtgatg
ggcgtcgcgaaggcggcgctggaggcgagcgtgcgctatctcgcggccgacctcggcgag
aagaacatccgcgtcaacgcgatctcggccgggccgatcaagacgctcgcggcctccggc
atcggcgacttccgctatatcctgaagtggaacgagcacaacgcgccgttgcggcgcaac
gtctccaccgaggacgtcggcggcagcgcgctgtatttcctctccgacctctcgcgcggc
gtcaccggcgaggtgcatcacgtcgattccggttaccacgtgctcggtatgaagcgcccg
gacgcgccggatatctcgctcggtggcaaggactag

DBGET integrated database retrieval system