KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2780Help
Entry
blr2780           CDS       T00109                                 

Definition
(RefSeq) NAD-dependent alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00071  Fatty acid degradation
bja00350  Tyrosine metabolism
bja00625  Chloroalkane and chloroalkene degradation
bja00626  Naphthalene degradation
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr2780
  Lipid metabolism
   00071 Fatty acid degradation
    blr2780
  Amino acid metabolism
   00350 Tyrosine metabolism
    blr2780
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    blr2780
   00626 Naphthalene degradation
    blr2780
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     blr2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_3 Sacchrp_dh_NADP ThiF SIS
Motif
Other DBs
NCBI-GeneID: 1054075
NCBI-ProteinID: NP_769420
RhizoBase: blr2780
UniProt: Q89RJ2
Position
3058723..3059790
Genome map
AA seq 355 aa AA seqDB search
MKSFKVADFKAPLQEFDEPTPQPSGTQVLIKVKAAGVCHSDLHIWEGGYDLGHGRKPLSL
KDRGINLPLTMGHETVGEIVAFGPDVKPTDQGDLRLGDVGLVYPWIGCGKCATCLGGDEN
MCLTPRSLGVYCDGGYSDHMLVPHPRYLLNLKGLDPATTAPYACSGVTTYSALKKVEQHF
DTPIVMFGAGGLGLMALSLLKAMGGKGAIMVDIDARKREAAEKAGALATVDPKAPDALEQ
LAKKAGGPIRAVIDLVGNAATTQLGFDCLTKGGKLVIVGLFGGGATWALPLIPIKAVTIQ
GSYVGNLRETQELLDLVRTKNVPPIPVTRQPLAKANDALVQLQQGAVVGRTVLTP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtttcaaggtcgccgatttcaaggcgccgctgcaggagttcgacgagcccacg
ccgcagccgtcgggcacgcaggtgctgatcaaggtgaaggccgccggcgtctgccacagc
gacctccatatctgggaaggcggttacgatctcggccatggccgcaagccgctgtcgctg
aaggaccgcggcatcaatctgccgctgaccatgggccacgagacggtcggtgaaatcgtg
gctttcggtcctgacgtgaagccgaccgaccagggtgatctcaggctcggcgatgtcggc
ctggtctatccctggatcggctgcggcaagtgcgcgacctgccttggcggcgacgagaac
atgtgcctgacgccgcgctcgctcggcgtctattgcgacggcggctattccgatcacatg
ttggtgccgcatccgcgctatctgctgaacctcaaagggctcgatcccgcgaccaccgcg
ccctatgcctgctcgggcgtcaccacctacagtgcgctgaagaaggtcgagcagcatttc
gacacgccgatcgtgatgttcggcgccggcggcctcggcctgatggcgctgtcgctgttg
aaagcgatgggcggcaagggcgcgatcatggtcgacatcgacgccaggaagcgcgaggcg
gcggagaaggccggcgcgcttgcgaccgtcgatcccaaggcgccggacgcgctggagcag
cttgccaagaaagcgggcgggccgatccgcgccgtcatcgacctcgtcggcaatgccgcg
acgacgcagctcggcttcgactgcctgaccaagggcggcaagctcgtcatcgtcggcctg
ttcggcggtggcgcgacctgggcgctgccgctgattccgatcaaggcggtgaccatccag
ggcagctatgtcggcaatctgcgcgagacgcaggaactgctcgacctcgtgcgaacgaag
aacgtgccgccgatcccggtgacgcgtcagccgctcgccaaggccaacgacgcgctggtg
cagttgcagcagggcgccgtggtcggacgcacggtgctgacgccgtag

DBGET integrated database retrieval system