KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2960Help
Entry
blr2960           CDS       T00109                                 

Definition
(RefSeq) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00970  Aminoacyl-tRNA biosynthesis
bja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    blr2960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bja03029]
    blr2960
Enzymes [BR:bja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     blr2960
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     blr2960
Mitochondrial biogenesis [BR:bja03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    blr2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 1053578
NCBI-ProteinID: NP_769600
RhizoBase: blr2960
UniProt: Q89R12
Position
3263958..3265307
Genome map
AA seq 449 aa AA seqDB search
MPDFPTLAKLSDDLESGRTTSRKLVEACLARIADPAGEGQRTFIHVDKDAALAAADAMDA
LRKVKAAPSRYAGIPISIKDLFDIKGQVTRAGSRALDDSPAAEHDAATVERLRKAGFVLI
GRTNMTEFAYSGIGINPHYGTPKGAWNRAEGHVPGGSSSGAAVSVLDGMAHGALGTDTGG
SCRIPAAFNGIVGYKPTQRRVPLDGAVPLSFSLDSIGPLARSVSCCAILDAVLANEPVVA
LRPRPVKGMRLAVPTTIALDDLDKAVAETFERALKTLADHGAIIERIEMAEFHDIGPMNA
KGGFAASESYAWHRYLITTKGDVYDPRVSVRIMRGEAQSAADYIDLLNERRSLIARVNAH
IAPYDALVLPTTANTPPKIADLADDKAFTTQNLRALRNCTLINMIDGCAISLPAHREGDV
PVGLMLAGAGGSDRRIFELAAGMEAVIRV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcccgattttccgacactggcgaagctctccgacgacctcgaaagcggccgcaccacc
tcccgcaagctggtcgaggcctgtctcgccaggatcgccgaccccgccggcgagggccag
cgcaccttcatccacgtcgacaaagacgccgcgctcgcggcggcggatgcgatggacgcc
ttgcgcaaggtcaaggccgcaccgtcgcgctatgccggcatcccgatctcgatcaaggac
ctcttcgacatcaagggccaggtgacgcgcgccggctcccgcgcgctcgacgattccccg
gcggccgagcacgacgccgcgacggtcgagcggctgcgcaaggccggcttcgtcctgatc
ggccgcaccaacatgaccgagttcgcctattccggcatcggcatcaatccgcattacggc
acgccgaagggcgcctggaaccgggccgagggccacgtgccgggcggctcgtcctcgggc
gcggcggtctccgtgctcgacggcatggcgcatggcgcgctcggcaccgacaccggcggc
tcctgccgcattccggcggccttcaacggcatcgtcggctacaagccgacgcagcgtcgc
gtgccgctcgacggcgcggtgccgctgtcgttctcgctcgacagcatcggaccgctggcg
cgatcggtcagctgctgtgccatactcgacgcggtgctcgcgaacgagccggtcgtcgcg
ctgaggccgcgcccggtgaagggcatgcggctggcggtgccgaccacgatcgcgctcgac
gacctcgacaaggctgtggccgagacgttcgagcgcgcgctgaaaacgctggccgatcac
ggcgccatcatcgagcgcatcgagatggctgaattccacgatatcggcccgatgaacgcc
aagggcggctttgccgcgtccgagagctacgcctggcaccgctatctcatcacgaccaag
ggggacgtctatgatccccgcgtatccgtgcgcatcatgcgcggcgaggcgcagagcgcg
gcggattacatcgatcttctcaacgagcgccgctcgctgatcgcccgcgtcaatgcgcac
atcgccccctatgacgccttggtgctgccgaccaccgccaacaccccgccgaagatcgcc
gaccttgccgacgacaaggcgttcaccacccagaacctgcgcgcgctgcgcaactgcacc
ctgatcaacatgatcgacggctgcgccatctcgctgcccgcacatcgcgagggcgacgtt
cccgtcggcctgatgctggcgggtgcgggcggatcggaccgccgtatctttgaacttgct
gccggcatggaggccgtaattcgtgtttga

DBGET integrated database retrieval system