KEGG   Bradyrhizobium diazoefficiens USDA 110: blr3598
Entry
blr3598           CDS       T00109                                 

Gene name
blr3598
Definition
(GenBank) ORF_ID:blr3598; unknown protein
  KO
K11894  type VI secretion system protein ImpI
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bja02044]
    blr3598 (blr3598)
Secretion system [BR:bja02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   blr3598 (blr3598)
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: BAC48863
UniProt: Q89P85
Position
3975474..3976856
AA seq 460 aa
MMVLRFNIENEPNLPDGGPVSFTVTGRRSVDIGRDRHLDWTLPDPARTISGKHCEVHFRD
GGYWLHDVSTNGTFLNGADQRMRGPHRLRDGDRLTIGHYIIGVSLEDEAGGRSPNHEAQL
HDPSVQQHADYGELWTADRDVPPPIDPHLLKKPREAARPVNPGFLDWAASVPAPGVDPFR
PSSPTSPYQPSVQDDDMNWAAGPVTAPKPQVERPPVKPTPRRPSVWIDDEPAGAQPPASL
SHQEVATPRKTQAAGEGPVTAKPVGGTEFARLVARAAGLPDNFFANKSDAELAEQLGIIL
RMTVDNLMALLQARTQAKQLTRSTSQTTVQALENNPLKFSPTAEEAMRILFGPPTRSYLD
AQRAFAQGFSDLKSHQLKTYMAMQHAVHELIADIDPTLMARELELQRGASSWLGTNKGKL
WDEFLTRWKAHLGRDNSAPIEIFMLHFSDYYDRGDKPGSK
NT seq 1383 nt   +upstreamnt  +downstreamnt
gtgatggtgcttcgctttaatatcgagaacgaaccgaaccttccggacggcggacctgtg
tcgtttacggtcaccggcaggcgctcggtcgatattggccgggatcgtcacctcgactgg
acgctgccggatccggcgcggacgatttccggaaagcactgcgaagtgcactttcgcgac
ggcggctattggctgcacgacgtctcaaccaacggcacctttctcaatggtgccgaccag
cgcatgcgggggccgcaccgcttgcgcgacggcgaccgactgacgattggtcactacatc
atcggagtttcgctggaggatgaggctggcgggcgcagcccaaaccatgaggcgcaactg
cacgacccctcggtccagcagcatgccgattacggagagctttggacggccgatcgtgac
gttccgccgccgatcgatccgcacctgttgaagaagccacgcgaggctgcgcggcccgtt
aatccggggttcctggattgggcggcgagcgtcccggcgccgggtgtagacccatttcga
ccgtcatcgccgacgtctccgtaccaaccgtccgtgcaggacgacgacatgaactgggca
gcgggtccggtcaccgcgccgaaaccgcaagtcgagcgccccccagtcaagccgacccca
cgccggccgtcggtgtggatcgatgatgaaccagccggtgcacagccgccggcatcgcta
tcacaccaagaggttgcgacgccgcgcaaaacgcaagcagcgggcgaggggcctgtcacg
gccaagccagtcggcggtaccgagttcgcgcgactggtggcgcgcgctgctggattgccg
gacaatttttttgccaacaagtccgacgccgaactcgccgaacagcttggcatcatcttg
cgtatgaccgtggataatctcatggcgctgctgcaagcgcgaacccaagccaaacagctg
acccgcagcaccagccagaccaccgtccaagccctcgaaaataatccgctgaaattctcg
ccgaccgcggaagaggcgatgcgcattctctttgggccgccgacgcgtagctacctcgac
gcacagcgcgcctttgcacagggcttcagtgatctcaaatcacatcagttgaagacctac
atggcgatgcagcacgctgtccatgagctgattgcggacatagatccgacgctgatggcg
cgcgagctcgagcttcagcgtggcgcaagctcctggctcggcacgaacaagggcaaactc
tgggacgagttcttgacgcgctggaaggcgcatcttggccgcgataacagcgcgccgatc
gaaatctttatgttgcacttctcggactattacgaccgcggcgacaagcccggttcaaag
taa

DBGET integrated database retrieval system