KEGG   Bradyrhizobium diazoefficiens USDA 110: blr3600
Entry
blr3600           CDS       T00109                                 

Gene name
blr3600
Definition
(GenBank) ORF_ID:blr3600; hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bja00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    blr3600 (blr3600)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bja02044]
    blr3600 (blr3600)
Secretion system [BR:bja02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   blr3600 (blr3600)
SSDB
Motif
Pfam: DotU OmpA Roughex
Other DBs
NCBI-ProteinID: BAC48865
UniProt: Q89P83
Position
3978239..3979765
AA seq 508 aa
MSDRDKPVNPFGRGERTIIRPNPGGKLPPAPTSQPPPGEGPAARPAYSPSPVPSPGAPTP
PSSFSPVPQGSNYASAPAIHPTEEWISTPAQGQVPQPMLPAGPPLRVDDLVAPNANPVMR
AAGPLLQLLGRLRVALMRASFASLMEQVADAIKFFEKDIRSAGISEHQANTAKYILCATA
DDIVQHIPTEERHVWTQYSMLSRFFGERVGGVRFFEILDHLKIDPLVNYPVLELQHACLA
LGFQGIHRTSGAGLANLQLIQRNLYELLRRVRPKTMTDLSPNWRGQALAGRRQRLRVPVW
LVAAVVAALLTGSYFVLRTLLAGRAENAAEVALALHPAGPIELKRQVVAPPPPPPPPPPP
DRITQLQRIRNALAKENTACAMTADQTPSFIVIRVCDLALFASGQATILDGFKPIALRVA
ATLDKEPGRIRVVGHTDSSPIRTVRFPTNFELSVERAKAVAAALKPGLTDGSRVDVEGKG
ADAPIASNTTPEGRAKNRRVEIFIERSE
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgagcgacagggacaagccggtcaatcctttcggtcggggcgaacggacgatcatccgt
cccaaccccggcgggaagttgccgccggcgccgacctctcagcctccgccgggcgagggg
cctgcagcacgtccggcctattcgccgtcacccgtaccttctcccggcgcgccaacgcca
ccatcatccttttcgcccgttccacagggctcgaactacgcctccgcgccggccatccat
ccaaccgaggaatggatctcgacacccgcgcaaggccaggtgccgcaacccatgctgccg
gcagggccgccgttgcgcgtcgacgatctcgtcgcgccaaatgccaatccagtgatgcgc
gctgcgggcccattgctgcaactgctcggtcggttgcgggtggcgctcatgcgcgcgtca
ttcgcgagcctgatggagcaggtcgcagacgctatcaaattctttgagaaggacatccgt
tcagcgggcatttccgagcaccaggccaacacagcgaaatatatcctgtgtgccactgcc
gacgatatcgtgcagcacatcccgaccgaggagcgtcacgtctggacgcaatactcgatg
ctgagccgcttcttcggcgagcgtgtcggcggcgtccgtttctttgagatcctcgaccat
ttgaagattgatccactggtcaattatccggtcctcgaacttcagcacgcctgcttggcg
cttggttttcagggcattcaccggacgtcaggggccggacttgcgaacctgcagctgatc
cagcgtaacctctatgaattgctgcgccgggtccggccgaagacgatgaccgacctgtcg
cccaactggcgcgggcaggcgctggcggggcgccggcagcgtttgcgtgttccggtctgg
ctcgtggcggccgtcgtcgccgcgctgctgaccgggtcctatttcgtcctgcggacgctc
ctcgctggccgggcagagaatgctgccgaggtggcgctcgcgctccatccggccggcccg
atcgagctcaagcgccaggtcgttgcaccaccgccgccacctccgcctccgccgccaccg
gatcgcatcacccagttgcaacgcatccgcaacgcgctcgcgaaggagaacacagcctgt
gccatgaccgcggaccagacccccagtttcatcgtgatcagggtctgcgatctggccttg
tttgcatcgggccaggcgaccatcctcgacggtttcaagccgatcgcactccgcgtcgca
gcaaccctcgacaaggagccgggacggatccgggtcgtcggccataccgacagttcgccg
atccgcacagtccgcttcccgacaaatttcgagttgtcggtcgagcgcgccaaggcggtt
gctgcggcactgaagcctggcttgaccgatggttcgcgcgtcgacgtcgagggcaaagga
gcagatgcgccaatcgccagcaacacgacacccgagggacgcgccaagaaccggcgcgtc
gagatctttatcgaacgcagcgaatag

DBGET integrated database retrieval system