KEGG   Bradyrhizobium diazoefficiens USDA 110: blr3724Help
Entry
blr3724           CDS       T00109                                 

Gene name
phbA
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00071  Fatty acid degradation
bja00072  Synthesis and degradation of ketone bodies
bja00280  Valine, leucine and isoleucine degradation
bja00310  Lysine degradation
bja00362  Benzoate degradation
bja00380  Tryptophan metabolism
bja00620  Pyruvate metabolism
bja00630  Glyoxylate and dicarboxylate metabolism
bja00640  Propanoate metabolism
bja00650  Butanoate metabolism
bja00900  Terpenoid backbone biosynthesis
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
bja01212  Fatty acid metabolism
bja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    blr3724 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    blr3724 (phbA)
   00640 Propanoate metabolism
    blr3724 (phbA)
   00650 Butanoate metabolism
    blr3724 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    blr3724 (phbA)
   00072 Synthesis and degradation of ketone bodies
    blr3724 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    blr3724 (phbA)
   00310 Lysine degradation
    blr3724 (phbA)
   00380 Tryptophan metabolism
    blr3724 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    blr3724 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    blr3724 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    blr3724 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bja04147]
    blr3724 (phbA)
Enzymes [BR:bja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     blr3724 (phbA)
Exosome [BR:bja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   blr3724 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt B12-binding
Motif
Other DBs
NCBI-GeneID: 1052201
NCBI-ProteinID: NP_770364
RhizoBase: blr3724
UniProt: Q89NV9
Position
4129502..4130674
Genome map
AA seq 390 aa AA seqDB search
MTDVVIVSAARTPVGSFNGAFGALSAHELGAVAIKGALDRAKVSPEDVDEVILGQVLSGG
EGQNPARQAAMAAGIPQEKTAWGMNQLCGSGLRSVALGLQQIANGDARIIVAGGMESMSM
APHLSHLRNGTKMGDVKFVDSMLKDGLMDAFRGYHMGVTAENIAARWQITREEQDAFATS
SQNKAEDAQKGGRFKDEIVPVTVKTRKGDVVVDQDEYIRPGTTQESLAKLKPAFNKEGSV
TAGNASGLNDGAAALVLMSADEASKRGLAPLARIVSWATAGVDPAVMGSGPIPASRKALE
KAGWRVKDLDLVEANEAFAAQAIAVNKDMGWDPSIVNVNGGAIAIGHPIGASGARVLTTL
LFEMQKRGAKKGLATLCIGGGMGVALTVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtggtaattgtctccgcggcgcggacgccagtcggttccttcaacggggcg
ttcggcgcgctgtccgcacacgagctcggagctgtcgcaatcaaaggcgccctggatcgc
gcgaaggtctcgcccgaggatgtcgatgaagtcatcctggggcaggtgctatccggtggt
gaggggcagaaccccgcgcggcaggccgcgatggcggccggcattccgcaggagaaaacg
gcatggggcatgaaccagctctgcggctcgggcctgcggtcggtcgcgcttgggctgcag
cagatcgccaatggtgatgccaggatcatcgtcgccggcggcatggagtccatgtcgatg
gcgccgcatctgtcgcatctgcggaacggcaccaagatgggcgacgtcaagttcgtcgac
tccatgctgaaggacggccttatggacgccttccgcggctatcacatgggcgtcacggca
gagaacatcgcggccagatggcagatcacccgcgaggagcaggatgcgttcgcgaccagc
tcgcagaacaaggccgaggatgcgcagaagggcggccggttcaaggatgagatcgttccg
gtcaccgtcaagaccaggaagggcgacgtcgtcgtcgaccaggatgaatatatccgcccc
ggcacgacgcaggagtcgctggccaagctgaagcccgctttcaacaaggaaggttcggtg
acggcgggcaacgcttcgggcctcaacgacggcgcggccgctctggtgttgatgagcgcg
gacgaagccagcaagcgcggcctggcgcctcttgccaggatcgtctcgtgggccacggcc
ggcgtcgatccggcggtgatgggttcggggccgattccggcctcgcgcaaggcgctggaa
aaggctggctggagggtcaaagatctcgacctcgtcgaggccaacgaagcctttgcggcc
caggccatcgccgtcaacaaggacatgggctgggatccgtcgatcgtgaacgtgaacggc
ggcgccatcgccatcggccatccgatcggtgcatccggcgcccgcgtgctgacgacgctg
ctgttcgagatgcagaagcggggtgcgaagaaggggcttgccacgttgtgcatcggcggc
ggcatgggtgtcgccctaacggtcgaacgctag

DBGET integrated database retrieval system