KEGG   Bradyrhizobium diazoefficiens USDA 110: blr4658Help
Entry
blr4658           CDS       T00109                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00052  Galactose metabolism
bja00500  Starch and sucrose metabolism
bja00520  Amino sugar and nucleotide sugar metabolism
bja00521  Streptomycin biosynthesis
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
Module
bja_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bja_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr4658 (glk)
   00052 Galactose metabolism
    blr4658 (glk)
   00500 Starch and sucrose metabolism
    blr4658 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    blr4658 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    blr4658 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    blr4658 (glk)
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     blr4658 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 1052405
NCBI-ProteinID: NP_771298
RhizoBase: blr4658
UniProt: Q89L90
Position
5158240..5159217
Genome map
AA seq 325 aa AA seqDB search
MIKATLEGRAALLADVGGTNARFALLTDGELGAITHMAVKDYATFQEALAAYLGASARAE
RPAHAILAASGAVQNARCALTNNSWIVDAEELRGAYGFSAVRLINDFEAVAWALPRLGPD
SLLQLGGRQQVPGAPLAAIGPGTGLGMAVSIPHPGGQIVLASEGGHATLAGGSLREDAVI
EHLRQRFGHVSAERILSGAGLENLYDALACIDGATPPKRRASDITRAGIEGTCPISRSAV
DMFCAMLGSVAGNLALALTARGGIFIGGGILRHLPDYLAASQFRQRFEEKGRLRKFLEPI
PAYLILDDDVAFVGLRNLMEVEGIG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggcgacgctggaaggacgagccgcgttgcttgcagatgttggagggaccaac
gcccgcttcgcactgctgactgacggcgagctcggcgcgatcacacatatggcggtcaag
gactacgctacctttcaggaggccctcgctgcctatctcggcgcttcggccagggccgag
aggcctgctcatgcaatcctcgccgcctctggcgcggttcagaatgcccgctgcgcactc
acgaacaattcctggatcgtcgacgcagaggaattgcgcggggcctatgggttttcggcc
gtccgtttgatcaacgactttgaagcggtcgcatgggccctgccccggcttggccccgac
agtttgctgcagctcggcgggcggcagcaggtgccgggggcaccccttgccgcgatcggc
cccggcaccggcctgggaatggcggtgagcataccacaccccggcggacagatcgttctc
gccagcgagggaggccatgccacgctggcaggcggttcgttgcgcgaggatgcggtgatt
gagcatttgcggcaacgcttcggacatgtgtcggccgaacgcattctgtcgggcgcgggg
ctcgagaacctgtatgacgctctcgcctgcatcgacggcgcgacgccgccaaagcgccgc
gcgtccgacattacgcgggccggaattgagggaacgtgtccgatcagccgctccgccgtt
gacatgttctgcgcgatgctggggtccgtcgcgggcaacctcgcgctcgcgctgaccgcg
agaggcgggatattcatcggcggcggcatcttgcgccacctgccggactatcttgccgcg
tcccagtttcgccagcgcttcgaggagaaggggcggctccgaaaattcctcgagccgata
ccggcctatctgatcctggacgacgacgtcgcattcgtcggcctccgtaacctgatggag
gtcgaaggcattggctga

DBGET integrated database retrieval system