KEGG   Bradyrhizobium diazoefficiens USDA 110: blr4824Help
Entry
blr4824           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr4824
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     blr4824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Acid_PPase Hydrolase
Motif
Other DBs
NCBI-GeneID: 1052159
NCBI-ProteinID: NP_771464
RhizoBase: blr4824
UniProt: Q89KS9
Position
5346360..5346986
Genome map
AA seq 208 aa AA seqDB search
MTSLSPGSADALLFDLGRVVLDIDFSKAIACWAGHAGCKPEAIIARYVRDSEAYRLHEVG
KISDEEYFASLRASLGIGISDAQFLEGWNAIFAGEMPDVAELLPRAAKQMPLYAFSNTNR
PHVDHFSKEYADLLGHFRELYLSSSIGLRKPDAAAFDHVVAAIGVPARRIVFFDDLAENV
EGARARGLTAVHVTSPRDVGDALEALGI
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgctctctcccggcagcgcggatgcgcttctgttcgacctcgggcgcgtcgtg
ctcgacatcgatttctccaaggcgatcgcctgctgggcgggacacgccggctgcaagccg
gaggcgatcattgcccgctatgtgcgcgacagcgaggcgtatcggctgcacgaggtcggc
aagatcagcgacgaggagtatttcgcctcgctacgcgcctcgctcgggatcggcatctcg
gatgcgcaattcctcgagggctggaacgcgatcttcgcgggtgagatgcccgatgtcgcg
gagctgttgccgcgtgcggcgaagcagatgccgctctacgccttctccaacaccaaccgg
ccgcatgtcgaccatttctcgaaggaatacgccgacctgctcggccatttccgcgagctg
tacctgtcgtccagcatcggcctgcgcaagccggacgcggcggcgttcgaccatgtcgtg
gcggccatcggtgtgcccgccaggcgcatcgtgttcttcgacgacctcgccgaaaacgtc
gagggagcgcgggcgcgcggattgaccgcggtgcatgtgacctcgccccgcgatgtcggc
gacgcgctcgaggcgctgggaatctga

DBGET integrated database retrieval system