KEGG   Bradyrhizobium diazoefficiens USDA 110: blr5112Help
Entry
blr5112           CDS       T00109                                 

Gene name
rnr
Definition
(RefSeq) exoribonuclease
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    blr5112 (rnr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bja03019]
    blr5112 (rnr)
   03016 Transfer RNA biogenesis [BR:bja03016]
    blr5112 (rnr)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     blr5112 (rnr)
Messenger RNA biogenesis [BR:bja03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     blr5112 (rnr)
Transfer RNA biogenesis [BR:bja03016]
 Prokaryotic Type
  tRNA degradation factors
   blr5112 (rnr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 S1 RNase_II_C_S1
Motif
Other DBs
NCBI-GeneID: 1051689
NCBI-ProteinID: NP_771752
RhizoBase: blr5112
UniProt: Q89K07
Position
5668829..5671171
Genome map
AA seq 780 aa AA seqDB search
MKRKNDRGFPDRQAIVAFIKANQGNVGTREIAREFGLKNADRVELKRMLRELADDGTIKK
KRHKVSEPDTLPSTLVADITGRDSDGELIASPTEWDEVESGEPPKILIVMPRRPKPGTAA
GVGDRALLRVERIDETEGPAYRGHIIKVFDKAKSRILGVFRSLPEGGGRLVPVDKKSADR
ELNIAAADTQGAQDGDLVSVDIVRSRAFGLASGRVKEKLGSVKSEKAISLIAIYAHDIPL
QFRPAAEREAEAAEPANLKGREDWRDVPLVTIDPPDAKDHDDAVHAQADDDPNNKGGFIV
NVAIADVSFYVRPGTALDRDALDRGNSVYFPDRVVPMLPERISNNLCSLVPGEPRGALAV
RMVIGPDGRKRSHTFHRILMRSAAKLNYAQAQAAIDGRPDDTTGPLLDPILRPLYTAYAC
VKRARDERDPLNLDLPERKILLKSDGTVDRVIVPERLDAHKLIEEFMILANVAAAEMLEK
KSLPLIYRVHDEPTLEKVHALAEFLETLDVPFAKSGALRPALFNRVLAQLEGHDHFPLVS
EVVLRAQAQAEYSAENYGHFGLNLRRYAHFTSPIRRYADLVVHRALVRALGLGEGALPDT
ETPETLGEVAAHISVTERRAMKAERETVDRLIAHHLADRIGSSFQGRVSGVTRAGLFVKL
SETGADGLIPIRSLGTEYFNYDESRHALVGTRSGAMHQLGDVVDVRLIEAAPIAGALRFE
LLSSSGETAPQGRRASGRQRRPSFKAHPGRSPAKKHKPAKPKKPGKGKKNKGKGQKGKAW
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgcaagaatgaccgtggctttcccgacaggcaagccatcgtcgccttcatcaag
gcaaatcagggaaacgtcggcacccgcgaaattgcgcgcgagttcggcctgaagaacgcc
gatcgcgtcgagctcaagcgcatgctgcgcgagctcgccgacgacgggaccatcaagaag
aagcgccacaaggtctcggaaccggacaccctgccgtcgacgctggtcgccgacatcacc
ggccgcgactccgatggcgagctgatcgcctcccccaccgaatgggacgaggtcgaaagc
ggcgaaccgccaaaaatcctcatcgtcatgccgcgccggccgaagcccggcaccgccgcc
ggcgtcggcgaccgcgccctgctgcgcgtcgagcgcatcgacgagaccgaaggcccggcc
tatcgcggccacatcatcaaggtcttcgacaaggccaagagccgcatcctcggcgtgttc
cgcagtctgcccgaaggcggcggacggctcgttcccgtcgacaagaaatctgccgaccgc
gagctgaacattgccgcggccgacacgcagggcgcccaggacggcgacctcgtcagcgtc
gacatcgtccgctcacgcgcctttggcctcgcctcaggccgcgtgaaggagaagctcggc
tcggtcaagtcggagaaggcgatcagcctgatcgcgatctacgcgcacgacattcccctg
caattccgccccgcggcagagcgtgaagccgaagcggcggagccggcgaacctgaagggg
cgcgaggactggcgcgacgtcccgctcgtcaccatcgatccgcccgatgcgaaagatcat
gacgacgcggtccatgcgcaggccgacgacgatcccaacaacaagggcggcttcatcgtc
aacgtcgccattgccgacgtgagcttctacgtgcggccgggcaccgcgctcgaccgcgat
gcgctcgaccgcggcaactcggtctatttccccgaccgcgtcgtgccgatgctgccggag
cgcatctccaacaatctctgctcgctggtgccgggcgagccgcgcggcgcgctggcggtg
cgcatggtgatcggcccggacggccgcaagcgctcgcatacgttccaccgcatcctgatg
cgctcggcggcgaagctgaactacgcacaggcgcaggccgcgatcgacggccggcctgac
gacaccaccggccccctgctcgatccgatcctgaggccgctctacaccgcctatgcctgc
gtcaagcgcgcaagagacgagcgcgatccgctcaatctcgatctgcccgagcgcaagatc
ctcttgaagagcgatggcacggtcgatcgcgtcatcgttcccgagcgtctcgatgcgcac
aagctgatcgaggagttcatgatcctcgccaacgtcgctgccgcggaaatgctcgagaag
aagtcgctgccgctgatctaccgcgtgcacgacgagccgacgctggagaaggtccacgcg
ctcgcggagtttctggagacgctcgacgttcccttcgccaaatcaggcgcgctgcgcccg
gccctgttcaaccgcgtgctggcccagctcgagggccacgaccacttcccgctggtgagc
gaagtcgtgctccgcgcccaggcgcaggccgaatattccgctgagaattacggtcatttc
ggcctgaacctgcgccgctacgcgcatttcacctcgccgatccgccgctatgccgacctc
gtcgtgcaccgcgcgctggtccgcgcgctcggccttggcgaaggtgcgctgcccgacacc
gagacaccggaaacgctcggcgaggtcgcagcccacatctcggtgaccgagcggcgcgcg
atgaaggcggagcgcgagaccgtggaccggctgatcgcgcaccatctcgccgaccgcatc
ggctccagcttccagggccgcgtttccggcgtcacgcgcgccggcctgttcgtcaagctg
agcgagaccggcgccgacggcctgatcccgatccgatcccttggcacggaatatttcaac
tatgacgagagccgccatgccctcgtcggcacgcgcagcggcgccatgcatcagctgggt
gacgtggtcgacgtccgtctgatagaagcagctccgatcgcgggcgcgctgcgcttcgag
ctgctgtcgtcaagcggcgagaccgcgccgcagggccgcagggcatccggtcggcaacgc
cgcccctcgttcaaggcgcatcccggacgcagtccggcgaagaagcacaagccggcgaag
ccgaagaagcccggcaagggcaagaagaacaagggcaaaggccagaagggcaaggcatgg
tga

DBGET integrated database retrieval system