KEGG   Bradyrhizobium diazoefficiens USDA 110: blr6070Help
Entry
blr6070           CDS       T00109                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00071  Fatty acid degradation
bja00350  Tyrosine metabolism
bja00625  Chloroalkane and chloroalkene degradation
bja00626  Naphthalene degradation
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr6070
  Lipid metabolism
   00071 Fatty acid degradation
    blr6070
  Amino acid metabolism
   00350 Tyrosine metabolism
    blr6070
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    blr6070
   00626 Naphthalene degradation
    blr6070
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     blr6070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 1051851
NCBI-ProteinID: NP_772710
RhizoBase: blr6070
UniProt: Q89HC4
Position
6685721..6686704
Genome map
AA seq 327 aa AA seqDB search
MRAMVLAAPRARLRMEERPDPIPGEGQIRVRVSACGVCRTDLHVVDAELPDIRYPIVPGH
EIVGRIDLVGPDVATHALGDRVGIPWLGFTCGNCRFCREGMENLCDRPLFTGYTRDGGYA
THVVADARYAFPLGEAGDDVALAPLLCAGLIGWRSLVLAGQAERLGIYGFGAAGHIVAQV
AVWQGRSVHAFTRRGDLAAQDLARRLGAVWAGASDEMPDTPLDAAIIYAPAGELVPAALR
AVRKGGRVVCAGIHMSDIPSFPYDLLWQERQLISVANLTRQDGLDFLRIAPQAGVRTETT
AFPLDQANEVLDMLRNGQILGAAVLRP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgatggtgttggctgccccgcgagcacggctgcggatggaggagcgccccgat
ccaatccccggcgaaggtcagatccgggtgagagtcagcgcctgcggcgtctgccggacc
gatcttcacgtcgtcgacgccgaattgcccgacatccgctacccgatcgtacctggccat
gaaatcgtcggccgtatcgatctcgtcggccccgatgtcgcaacgcatgcgctgggtgac
cgggtcggcattccctggctcgggttcacctgcggaaactgccggttttgccgggagggc
atggagaacctctgcgaccgcccgctcttcaccggttatacaagggacggcggctatgca
acgcacgtggtcgccgatgcgcgctatgcctttccgctgggcgaggccggcgacgacgtg
gctctcgcccctctgctgtgtgcaggcctgatcggctggcgttcgctggtcctcgccggc
caggctgagaggctgggcatctacggcttcggcgccgccggccatatcgtcgcgcaagtc
gcggtctggcaggggcgctctgtccacgcgtttacacggcgcggcgatctggccgcgcag
gacctcgcccgccggctcggcgccgtctgggcgggcgcctcggacgaaatgcccgacaca
ccgctcgacgccgccatcatctatgctcccgccggcgagctcgtgccggccgcgctgcgc
gccgttcgcaagggtggccgcgtggtctgcgccggcatccatatgagcgacattccgagc
tttccgtacgacctgctctggcaggaacggcagctgatctccgttgccaatctcacccga
caggacggtctcgattttctcaggatcgctccgcaggcgggcgtgcgcaccgagacgacc
gcattcccgctcgatcaggccaacgaagttctggacatgctgcggaatggacagattctt
ggcgccgccgtgctcagaccctga

DBGET integrated database retrieval system