KEGG   Bradyrhizobium diazoefficiens USDA 110: blr7560Help
Entry
blr7560           CDS       T00109                                 

Gene name
dhlB
Definition
(RefSeq) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00361  Chlorocyclohexane and chlorobenzene degradation
bja00625  Chloroalkane and chloroalkene degradation
bja01100  Metabolic pathways
bja01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    blr7560 (dhlB)
   00361 Chlorocyclohexane and chlorobenzene degradation
    blr7560 (dhlB)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     blr7560 (dhlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 1047349
NCBI-ProteinID: NP_774200
RhizoBase: blr7560
UniProt: Q89D82
Position
8296153..8296884
Genome map
AA seq 243 aa AA seqDB search
MSLKAVVFDAYGTLYDIQSVADITEDAFPGYGEIITQVWRIKQLEYTWLRSLMQRYQDFD
AVTRDSLAYTLRILGLAYEREEFERVIEKYLHLDLYPDATSALAALKPRQLAILSNGSPD
MLNGLVRNTKLDRLLDATISVDAKKVFKPSPAAYELIGEVLGTAPDEVLFVSSNPWDVAG
AKSYGLNVAWIERVTPEAMALACVENELVAPLTMFKAIRTQMDELGFAPDHRVRALSELP
SII
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcaaagccgtcgtcttcgacgcctacggaacgctctacgacatccagtcggtc
gctgacatcaccgaggatgcgtttccgggctacggcgagatcatcacgcaggtctggcgc
atcaagcagctcgaatacacctggttgcgctctctgatgcagcgctaccaggactttgac
gcggtcacgcgcgactcactcgcctatacgctgcgcatccttgggctcgcttatgagcgc
gaggaattcgagcgcgtgatcgaaaagtatctgcatctcgatctctatccggatgcaaca
agcgcgcttgcggccttgaagccccgacaactcgccatcctctccaacggcagtccggac
atgctgaacgggctcgtgcgcaacaccaagcttgaccgcctgctcgatgccaccatcagt
gtcgatgccaagaaggtcttcaagccgagcccggcggcctatgagctgatcggcgaggtg
ctcggcaccgcgccggacgaggttctgttcgtctcctccaatccctgggacgtggcgggc
gcgaagtcgtatggcttgaacgtcgcatggatcgagcgggtgacgcccgaggcgatggcg
ctggcttgcgtcgagaacgaactcgtggcaccgctgacgatgttcaaggcgatccgcacc
cagatggacgagcttggctttgcgccggaccaccgcgtccgcgcactctccgagctgcca
agtatcatctga

DBGET integrated database retrieval system