KEGG   Bradyrhizobium diazoefficiens USDA 110: blr7807Help
Entry
blr7807           CDS       T00109                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00061  Fatty acid biosynthesis
bja00071  Fatty acid degradation
bja01100  Metabolic pathways
bja01212  Fatty acid metabolism
bja02024  Quorum sensing
Module
bja_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    blr7807
   00071 Fatty acid degradation
    blr7807
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    blr7807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bja01004]
    blr7807
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bja04147]
    blr7807
Enzymes [BR:bja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     blr7807
Lipid biosynthesis proteins [BR:bja01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   blr7807
Exosome [BR:bja04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   blr7807
  Exosomal proteins of breast cancer cells
   blr7807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 1048445
NCBI-ProteinID: NP_774447
RhizoBase: blr7807
UniProt: Q89CJ0
Position
8557377..8559029
Genome map
AA seq 550 aa AA seqDB search
MVMPRWSSISFQQPRPVVMDPGLRRDDTFLVERPTLMTHPSIHARATPNKIAYQMAGTGK
AITYRELDELSNQGAHLFRSLGLKAGDHIALLMENRLAFMELCWAAQRSGLYYTAISRYL
KQDEIDYIIADCGAKVVITTPKCADQIKALIKGTPGEPVFYMMDEPLPGFRSYDKEAAAQ
PTTPISDEVAGYDMLYSSGTTGRPKGIKKAFEGNKIDVPNAFLRVLCADMCGMNAASTYL
SPAPLYHAAPLRFNMMAIVLGGTSIIMEHFDAEEFLKLVEKYEVTQSQLVPTMFVRMLKL
PDEVRYRYNVSTLKGAIHAAAPCPVDVKAKMIEWWGPILIEYYAGSEGNGVTVCNSQQWL
EHRGSVGRAVVGKIKILDENDEEQPTGEIGTVYFADAPAFAYHNDPEKTKKAYNAKGWST
LGDVGYLDKDGFLFLTDRKSYMIISGGVNIYPQETEDVLITHPDVADVAVFGVPNEEMGE
EVKAVVQPHDMTRAGKALEADLIAFCKGRLSAIKCPRSIDFEAELPRTPTGKLVKRHLRD
RYWPKTTAKI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtggttatgccgcgctggagctccatctcgtttcaacaaccgaggcctgtggttatggat
cccggccttcgccgggatgacacctttcttgttgagagacctacgctcatgacccacccc
tccatccacgcccgcgccacgccgaacaagatcgcttaccagatggcgggcaccggcaag
gcgatcacctatcgcgaactcgacgagctctcgaaccagggcgcacacctgttccgctcg
ctcggcctgaaggccggcgatcacatcgcactgttgatggagaaccggcttgccttcatg
gagctctgctgggccgcgcagcgcagcgggctctattacaccgcgatcagccgctatctg
aagcaggacgagatcgactacatcatcgccgattgcggcgccaaggtcgtgatcaccacg
ccgaaatgcgccgaccagatcaaggccctgatcaagggcacgcccggcgagccggtcttc
tacatgatggacgaaccgctgcccggcttccgctcctacgacaaggaagccgccgcgcag
ccgacgacgccgatctccgacgaggtcgccggctacgacatgctgtattcgtccggcacc
accggccggcccaagggaatcaagaaggcgttcgagggcaacaagatcgacgtgccgaac
gccttcctgcgcgtgctctgcgccgacatgtgcggcatgaatgcggcgagcacgtacctc
tcgccggcgccgctctatcacgcggcgcccctgcgcttcaacatgatggcgatcgtgctc
ggcggcacctccatcatcatggagcatttcgacgccgaagaattcttgaagctggtcgaa
aagtatgaggtcacgcagtcgcagctcgtgccgaccatgttcgtgcggatgctcaagctg
ccggacgaggtgcgctaccggtacaacgtctcgacgctcaagggcgcaatccacgccgca
gccccctgcccggtcgacgtcaaagccaaaatgatcgaatggtggggaccgatcctgatc
gagtattacgccggctcggaaggcaacggcgtcaccgtctgcaactcgcagcaatggctg
gagcatcgcggcagcgtcggccgcgccgtggtcggcaagatcaagattctcgacgaaaac
gacgaggagcaaccgaccggcgaaatcggcacggtctatttcgccgacgcgcctgctttc
gcctatcacaacgaccccgagaagacgaagaaggcctacaacgccaagggctggtcgacg
ctcggtgacgtcggctatctcgacaaggacggcttcctgtttctcaccgaccgcaagtcc
tacatgatcatttccggcggggtgaacatctacccgcaggagaccgaggacgtgctcatc
acccaccccgatgtcgccgacgtcgccgtattcggcgtgccgaacgaggagatgggcgag
gaggtgaaggcggtggtgcagccgcacgacatgacgcgtgcgggcaaggcgctggaagcc
gacctgatcgcgttctgcaagggtcgcctctccgcgatcaagtgcccgcgttcgatcgat
ttcgaggcggagctgccgcgcacgccgacgggcaagctggtgaagcggcatttgcgcgac
aggtattggccgaagacaacagcgaagatctag

DBGET integrated database retrieval system