KEGG   Bradyrhizobium diazoefficiens USDA 110: blr7896Help
Entry
blr7896           CDS       T00109                                 

Definition
(RefSeq) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00330  Arginine and proline metabolism
bja00360  Phenylalanine metabolism
bja00380  Tryptophan metabolism
bja00627  Aminobenzoate degradation
bja00643  Styrene degradation
bja01100  Metabolic pathways
bja01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    blr7896
   00360 Phenylalanine metabolism
    blr7896
   00380 Tryptophan metabolism
    blr7896
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    blr7896
   00643 Styrene degradation
    blr7896
Enzymes [BR:bja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     blr7896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 1050124
NCBI-ProteinID: NP_774536
RhizoBase: blr7896
UniProt: Q89CA1
Position
8658031..8659503
Genome map
AA seq 490 aa AA seqDB search
MAKSEWSFKSAVELSAALSAKKVSAVELTRDAIGRIERHDGKINAICVRDFDRALGAARE
ADAALVRGERKPLLGLPLTIKESFNIAGLPTTWGFVPQKDFKPVEDALPVARIKQAGGVI
LGKTNVPVGLSDWQSYNDIYGTTNNPYDLGRTPGGSSGGSSAALAAGYCALATGSDIGGS
LRVPAFHCGIFAHKPTINLCAARGETPPPFPAIPREGDLAVIGPMARTAADLSLLLDVMA
GPDPLDAGVAYKLDLPVARHQSLRDFRVLVIESHPLLPTDRDVRDAIDKLATDLAKAGVT
VARESPLLPDFADTSRLYMRMLLGFLGAFFLPDELADSQARASQLSPEDRSLEAERLRGT
IASHRAWVLDAGSRAGLRAQWRALFKSFDAVICPIMPTPAFPHDHSPEQSLRRISIDGKD
YPYSDQLAWPGVATLPGLPATAVPLGLSKDGLPVGVQIVGPFLEDRTPLRLAELIEREFG
GFTPPPLFYD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaatcggaatggagtttcaagagcgcagtcgagctgtcggccgcattgagcgcg
aagaaggtctcggcggtcgagctcacgcgggacgcgattggccgtatcgagcgtcatgac
ggcaagatcaacgcgatctgcgtgcgggatttcgatcgggcgctcggcgccgcgcgcgag
gcggacgctgcattggtccgcggcgagcgcaagccgctgctcggcctgcccctgacgatc
aaggaatcctttaacatcgccggcctgccgacgacctggggcttcgtcccgcagaaggat
ttcaagcctgtcgaagacgcgctgccggtcgcacgcatcaagcaggccggcggtgtgatc
ctcggcaagaccaacgtgccggtcggtctcagcgactggcagagctacaacgacatctac
ggcaccacgaacaacccctatgatctcggccgcacgccgggtggatcatccgggggatct
tcggcagccctcgccgcaggctattgcgcgctcgccaccggctccgacatcggcggctcc
ctgcgtgtgccggcatttcattgcggcatcttcgctcacaagccgaccatcaatctctgc
gcagcgcgcggcgagactccgccgccgtttccggccattccgcgcgaaggcgacctcgcc
gtcatcggtccgatggcgcgcaccgctgcggatctctccttgctgctcgacgtcatggcc
ggaccggatccgctcgatgccggcgtcgcctacaaactcgatctgcctgttgcgcggcat
cagtcgctgcgcgattttcgtgtcctggtgatcgagagccatccgctgctgccgactgac
cgggacgtgcgcgacgcgatcgacaagctcgccaccgatcttgcgaaggccggcgtgacg
gtcgcgcgcgagagcccgctgcttccggacttcgcggacacgtcgcggctttacatgcgc
atgctgctgggcttcctcggcgcgttcttcctgcccgacgagctggcggattcgcaggct
cgggcgagccagttgtcgccggaggaccgaagcctcgaagcggagcggctgcgcggcacg
attgcaagccaccgcgcctgggtgctcgacgcaggtagccgcgccggcctgcgggcgcaa
tggcgcgcgctgttcaagagcttcgacgcggtgatctgcccgatcatgccgacgccggcc
tttccgcacgatcattcgccggagcagagcctgcgacgcatcagcatcgacggcaaggac
tacccttattccgaccagctcgcctggccgggcgtcgcgacgcttccgggcctgccggcg
acggccgttccgctcggcctgtcgaaagacggcttgcccgtcggcgtccagatcgtcggc
cccttcctggaggaccgcacccccttgaggctcgccgaactgatcgagcgcgagttcggc
ggcttcacaccgccgccattgttctatgattag

DBGET integrated database retrieval system