KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8118Help
Entry
blr8118           CDS       T00109                                 

Definition
(RefSeq) ABC transporter permease
  KO
K02029  polar amino acid transport system permease protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Module
bja_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:bja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bja02000]
    blr8118
Transporters [BR:bja02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    blr8118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 1049041
NCBI-ProteinID: NP_774758
RhizoBase: blr8118
UniProt: Q89BN0
Position
8910315..8910977
Genome map
AA seq 220 aa AA seqDB search
MYHWDFGILWSYRWLFLNGLGVTVGFTVVIVVLGLVFGLFGAFGSLSRLKAVRLVALTFI
EAFRCTPILVQLIWFYYALPILAGVEMTPITASALALSLYGGSFYSEIIRGGIVSIDKGQ
SEAGAALGMTPGQAMRRIVLPQAIKRMIPALMNQSIIQFKNTSLVSVLAVPDLVYQSQVA
AHDSYRPLETYTAVAVAYAAILIPLTIIVRRGEKRLAVGE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtatcactgggacttcggcattctctggagctatcgctggctctttctcaacgggctc
ggcgtcaccgtcggcttcaccgtggtcatcgtggtgctcggactggtgttcggcctgttc
ggcgcattcggcagcctgtcgcgtctcaaggcggtgcgcctcgtcgccctcaccttcatc
gaggcgttccgctgcacgccgattctggtgcagctgatctggttctattacgcgctgccg
atcctcgccggcgtcgagatgacgccgatcacggcctcggcgctggcgctgtcgctctat
ggcggctcgttctattcggagatcatccgcggcggcatcgtctcgatcgacaagggccag
tccgaagcgggtgccgcgctcggcatgacccctggccaggcgatgcggcgcatcgtgctg
ccgcaggcgatcaagcgcatgatcccggcgctgatgaaccagtcgatcatccagttcaag
aacacctcgctggtctcggtgctggcggtgcctgacctcgtctatcagagccaggtcgcg
gcccatgacagctaccggccgctggagacctacacggcggtcgcggtcgcctatgccgca
atcctgattccgctcaccatcatcgtccggcgcggcgagaagcgattggcggtcggcgaa
tga

DBGET integrated database retrieval system