KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8123Help
Entry
blr8123           CDS       T00109                                 

Definition
(RefSeq) mutT/nudix family protein
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00760  Nicotinate and nicotinamide metabolism
bja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    blr8123
Enzymes [BR:bja01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     blr8123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase NUDIX-like DZR HypA DUF1451 zf-C3HC4_3 zf-C3HC4_2 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 1048970
NCBI-ProteinID: NP_774763
RhizoBase: blr8123
UniProt: Q89BM5
Position
8914345..8915289
Genome map
AA seq 314 aa AA seqDB search
MSAFDAFPLGQPAFVTNILDRAAHLRRDDEKLFALEQKPSSRAYVVHRDSLLVKREGENV
RALLGIDEALKCGANPGTIFLGLRDGAAVFGMGLSQAAAEKLVGREDYSLTELRGMAMQG
AIPPDELSAIAMAKSMVSWHQRHGYCANCGTRSAMKEGGWKRDCPACKAEHFPRTDPVVI
MLVASGEKCLLGRQKQFPPGMFSCLAGFVEAAETIEDAVRREILEESGIRCTDVQYYMTQ
PWPYPSSLMIGCSARALNEDIVVDHSELEDARWFTREEAALMLTRTHPDGLAGPHPFAIA
HHLLGRWVHDKSGA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcattcgacgcatttccgctgggacagccggccttcgtcaccaacatcctcgac
cgcgccgcgcatctgcgccgcgacgacgaaaagctgttcgcgctggagcagaagccgtcc
tcgcgcgcctatgtcgtccaccgcgactcgctgctggtgaagcgcgaaggcgaaaacgtg
cgcgcgctgctgggaatcgacgaggcgctgaaatgcggcgccaatcccggcacgatcttc
ttaggcttacgcgacggcgccgctgtgttcggcatgggcctgtcgcaggccgccgccgag
aagctggtcggccgcgaggactacagcctcaccgagctgcgcggcatggccatgcagggc
gcgattccccccgacgagctttcggcgatcgcgatggcgaagtcgatggtgagctggcac
cagcgccacggctattgcgccaattgcggcacgcgcagcgcgatgaaggaaggcggctgg
aagcgcgattgccctgcctgcaaggccgagcattttccgcgcaccgatccggtcgtgatc
atgctggtcgcctccggagaaaaatgcctgctcggccgccagaagcagtttccgccgggc
atgttttcctgcctcgccggcttcgtcgaggccgccgagaccatcgaggacgcggtgcgc
cgggagatcctcgaagaatccgggatccgctgcaccgacgtgcagtattacatgacgcag
ccgtggccctacccgtcgtcgctgatgatcggctgcagcgcgcgggcgctgaacgaggac
attgtcgtcgatcattcagagctggaggatgcgcgctggttcacgcgcgaggaggcggcg
ctgatgctgacgcggacgcatcccgacgggctcgccggcccgcatcccttcgccatcgcc
catcacctgctcggccgctgggtgcacgacaagagcggcgcttga

DBGET integrated database retrieval system