KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8160Help
Entry
blr8160           CDS       T00109                                 

Gene name
modA
Definition
(RefSeq) ABC transporter molybdenum-binding protein
  KO
K02020  molybdate transport system substrate-binding protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja02010  ABC transporters
Module
bja_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    blr8160 (modA)
Transporters [BR:bja02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    blr8160 (modA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 SBP_bac_8
Motif
Other DBs
NCBI-GeneID: 1048681
NCBI-ProteinID: NP_774800
RhizoBase: blr8160
UniProt: H7C6I9
Position
8962069..8962851
Genome map
AA seq 260 aa AA seqDB search
MSRLSVFFSAFIVLLAALSPAAAEDKTITVFAAASMKNALDEIDAAYTAKTGVKFSVSYA
ASSVLAKQIEQGAPADVFVSADTDWMDYAISRKTINEPSRVNLLGNSIVLIAPKDSKIDN
VTIAQGFDLAKLAGDGRIATGDVKSVPAGKYAKAALEKLGAWQAAEPKFAMAESVRAALT
LVARGEADLGIVYSTDAKVEPGVKIVGTFPADSHPAIIYPVAATVTAKGETSDYLAFLRS
TAAKTILEKYGFKFLISPTT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcctttccgtatttttttccgccttcatcgttttgctcgcggctttgtcgccc
gccgccgccgaggacaagaccatcaccgtgttcgccgccgcctcgatgaagaacgcgctc
gacgagatcgacgcggcctacaccgcgaagaccggcgtcaagttcagcgtcagctatgcc
gcaagctcggtgctcgccaagcagatcgagcagggcgcgcccgccgacgtgttcgtctcc
gccgacaccgactggatggactacgcgatctccaggaagaccatcaacgagccttccaga
gtcaacctgctcggcaacagcatcgtgctgatcgcgccgaaggattccaagatcgacaac
gtcaccatcgcgcagggcttcgacctcgccaagctcgcgggcgacggcaggatcgcgacc
ggcgacgtcaagtcggtgccagcaggcaaatatgccaaggctgcactggagaagctcggc
gcgtggcaggcggccgagccgaaattcgccatggccgagagcgtgcgcgccgcgctgacg
ctggtcgcccgcggcgaggccgatctcggcatcgtctattcgaccgacgccaaggtcgag
ccgggcgtgaagatcgtcggcaccttcccggcggattcgcatcccgcgatcatctatccc
gttgccgcgaccgtgaccgcgaagggcgagaccagcgactatctcgccttcctgcgctcg
accgcggccaagacgatcctggaaaaatacggcttcaagttcctgatcagccccacgacg
tga

DBGET integrated database retrieval system