KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8172Help
Entry
blr8172           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-GeneID: 1048587
NCBI-ProteinID: NP_774812
RhizoBase: blr8172
UniProt: Q89BI0
Position
8973193..8974152
Genome map
AA seq 319 aa AA seqDB search
MSTQAQQTTSGQTTLAFEIGLLLLLALIWGSSFTLIKVAIPSIPPFTMVAARVTIAAILL
LLIARAQGHALPRRGSVWAAFLVQGLLQSALPFTLISWGETHIASGLAGVLNATPPMFVL
AIALTTGRGRQTVSGRKIIGVALGLAGVAVTMGADALSGIGTTAPLAQAAVLCASLCYAV
APIWGQRFSGLPAIVTAAGAMSCAAVLMLPAAAVLERPWTLAPPPAQAIAAVIALAVICT
AFAMVIYFRLIHTLGPLGTTSGSYLRAGFAVALGTAWLGERFSWSSLAGMALILAGVVAV
TVPAPARTGKTATGAPSRN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcaggcgcaacaaacgacgtcaggacaaaccacgctcgcgttcgaaatcggg
ctcctgctgctgctggcgctgatctggggcagctcgttcacgctgatcaaggtcgcgatc
ccctcgattccgcccttcacgatggtcgcggcgcgggtgacgatcgcagccattctcctg
ctcctgatcgctcgcgcgcagggacacgcccttccccgccggggatcggtgtgggctgcg
ttcctcgtgcagggcctgctgcaaagcgcgctaccgttcaccctgatcagctggggcgag
acgcatatcgccagcggcctcgccggcgtgctcaatgcgaccccgccgatgttcgtgctc
gcgatcgcgttgacgaccgggcgcgggcggcagaccgtcagcggccggaagatcatcggc
gtcgctcttggccttgcgggcgttgccgtgaccatgggcgccgacgcgctctcggggatc
ggcacgaccgctccgctggcgcaagcggccgtgctgtgcgcgagcctctgctacgcggtc
gcgccgatatggggacagcgcttctcgggccttcccgcgatcgtcacggccgccggagcc
atgagctgcgcagcggtgctgatgctccccgcggccgccgttctcgaacggccatggacg
ctggcgccgccgcccgcgcaggcgatcgcagcggtgatcgcgctcgcggtgatctgcacg
gcgttcgcgatggtgatctatttccggctgatccacacgcttggcccgctcggcacgacc
agcggcagctatctgcgcgcgggcttcgccgtggcgctcggcaccgcgtggcttggcgag
cgttttagctggtccagtcttgccggaatggcgctcatcctcgccggcgtggtggcggtc
acggtgcccgctcctgcacggaccggcaagacagcgaccggcgcaccgtcccgcaattga

DBGET integrated database retrieval system