KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8173Help
Entry
blr8173           CDS       T00109                                 

Gene name
radC
Definition
(RefSeq) DNA repair protein
  KO
K03630  DNA repair protein RadC
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    blr8173 (radC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RadC HHH_2 HHH_5
Motif
Other DBs
NCBI-GeneID: 1048640
NCBI-ProteinID: NP_774813
RhizoBase: blr8173
UniProt: Q89BH9
Position
8974193..8974813
Genome map
AA seq 206 aa AA seqDB search
MPAKADHDKTKPEDAPHYHGHRERLRERFYSAGADALSDYELLEMALFPALPRRDTKPLA
KTLIKIFGSFAEVVHAPVARLREIDGIGESAIHQLKLIAAAAHRVAKGEVNSRNALSSWN
EVIDYCRTSIMVVAFADKEQFRLLFLDKRNQLIADEVQQTGTVDHTPVYPREVIKRALEL
SATALILVHNHPTTHPMITLDHVQYR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaaagccgaccacgacaagaccaagccggaggacgcgccgcactatcacggc
catcgcgagcggttgcgcgagcgcttttacagcgccggggcggatgcgctcagcgactac
gagcttttggagatggcgctgtttccggcgctgccgcggcgcgacaccaagccgctcgcg
aagacgctgatcaagattttcggctcgttcgccgaggtcgtgcacgcgccggtggcgcgc
ttgcgcgagatcgacggcatcggcgaatccgcgatccaccagctcaagctgatcgcagcc
gccgcgcatcgcgtcgccaagggcgaggtcaacagccgcaacgcgctgtcgtcctggaac
gaggtgatcgactattgccgcaccagcatcatggtggtggcctttgccgacaaggagcaa
ttccgtctgctcttcctcgacaagcgcaaccagctcatcgccgacgaggtgcagcagacc
ggcaccgtcgaccacaccccggtctatccgcgcgaggtgatcaagcgcgcgctggagctg
tcggcaaccgccttgatcctggtgcacaaccaccccactacccaccctatgatcacgttg
gatcacgttcaataccgatga

DBGET integrated database retrieval system