KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8187Help
Entry
blr8187           CDS       T00109                                 

Definition
(RefSeq) dehydrogenase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 DUF3322 RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 1048484
NCBI-ProteinID: NP_774827
RhizoBase: blr8187
UniProt: Q89BG7
Position
8991296..8992174
Genome map
AA seq 292 aa AA seqDB search
MKTWLITGCSSGFGQRLALAAAERGDQVVATARSVKTIEDMAEPFDGRMITVPLDVTDAA
AAKAAVAKAVETFGGFDVLVNNAGYGLHGAIEEGTSDEYRPMFEVNLFGLIEATRAALPV
MRRSGGAIVNMSSVAGISGGGGGGYYNAAKFAVEGISEALASELKPFGIRVLIVEPGPFR
TDFLGRSITVAANEMPEYAGTSRRHYRETNNGNQAGDPDKAIAVILRAVDDDDAPLHLPL
GPVAHAAAERKLAAFRSDIDAWHDITIATDFDPPGTRVASSDRTSTSTGQRP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttggctcatcacaggctgctcaagcggcttcggccagcggctcgcgctcgcg
gcggcggagcgcggcgatcaggtcgtcgcgacggcccgcagtgtcaagacgatcgaggat
atggccgagcctttcgacggccgcatgatcaccgtgccactggacgtgaccgatgcggcg
gcagccaaggccgcggtcgcaaaagcggtcgagaccttcggcgggttcgacgtgctcgtc
aacaatgccggatacggactgcatggcgcgattgaggaggggacgtctgacgaataccgg
ccgatgttcgaggtaaacctcttcggtttgatcgaagccaccagagccgccctgcccgtc
atgcggcgctcgggcggagcgatcgtcaatatgtcgtccgtcgccggcatctcgggcggc
ggaggcggcggttactacaacgccgccaagttcgccgtggaagggatttccgaagcgctc
gccagcgagttgaagccgttcggcatccgagtgctgatcgtggagcctgggccgtttcgc
accgatttcctcggccgttcgatcacagtcgccgccaacgagatgccggaatatgccggg
acctcgcgcaggcactatcgcgaaaccaataacggcaatcaggcgggcgaccccgacaag
gcgatcgcagtgatcctgcgcgccgtcgacgacgacgacgccccgcttcacctgccgctc
ggcccggtcgcgcatgctgccgccgagcgaaagctggctgccttccgcagcgatatcgac
gcctggcacgacatcacgatcgctaccgatttcgacccgcccggaacgcgggtcgcgagc
tccgatcgaacgtcaacatcgacgggacagcgaccatga

DBGET integrated database retrieval system