KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8193Help
Entry
blr8193           CDS       T00109                                 

Definition
(RefSeq) site-specific integrase/recombinase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase DUF455
Motif
Other DBs
NCBI-GeneID: 1048348
NCBI-ProteinID: NP_774833
RhizoBase: blr8193
UniProt: Q89BG1
Position
8995713..8996813
Genome map
AA seq 366 aa AA seqDB search
MLEELFAGEVLEIRVVDPALAHPFVGQAVNLLEQQQPNHEAGRDACPYSPPTSATPTIAT
QPTTSPARRIPTKRAHIEVTHHLTNAEVEAIIAAPDQTTSRGRRDRAFLLFLARTGARVS
EATGVNANDLQLERGRPQVLLHGKGRRDRVVPIPQDLVRSLTNLLSERGLAHHEPRPIFV
GVHNERLTRFGATHIVRRAASQAGSTRPSLEGKPISPHIFRHSLAMKLLRSGVDLLTIQA
WLGHAQVATTHRYAAADVEMMRRGLEKAGVSGDGSASGPDRRRQICRWPAALPAGGYLRP
RQGRARPPVDGAMDGQARLRARDHGRLHLQRGQEGRTGLCRRNHFADARSGLRIDKDGLF
MGLCQG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagaactcttcgccggtgaagtactggaaatacgggtcgtggacccagcgctc
gcacaccccttcgtcggacaggccgtaaatctgcttgagcagcagcagcccaatcacgaa
gcgggtcgcgatgcctgcccttactcgccacctacctcggccacgccaactatagcgaca
cagcctactacctcaccggctcgtcggatccccaccaaacgggcccacatcgaggtgacg
catcatctcaccaacgccgaggtggaggctatcatcgcagcccctgatcagacgacgtcc
cgcggtcggcgcgaccgggcctttctgctcttcttggcgagaaccggcgctcgcgtgtcc
gaagcgaccggcgtcaacgcgaacgaccttcagttggagcgaggacgcccgcaggtgctg
cttcatggcaagggacgccgagatcgcgtcgttcccattcctcaggatttggtgcgatcg
ctgaccaacctattgagcgaacgcggcctcgcccatcatgaaccgcggccaatcttcgtc
ggggtccacaacgagcgcctgacgcgtttcggcgcgacacacatcgtgcggcgtgccgcc
tcccaggccgggtccacgaggccaagcttggagggcaagccgatatcgccgcacatcttc
cggcattccctcgccatgaagcttctccggtcaggcgtggacctcctgacgattcaggct
tggcttggccatgctcaggtcgccacgacccaccgatacgccgctgcggatgtcgagatg
atgcgccggggacttgagaaggcgggcgtctcaggcgacggaagcgcttctggcccagat
cgccgtcgccaaatatgccgatggcctgccgctctaccggcaggaggctatctacgcccg
cgacaaggtcgagctcgaccgccagttgatggcgcaatggatgggcaagctcggcttcga
gctcgagatcatggccgactacatcttcagcgaggtcaagaaggccgaacgggtctttgc
cgacgaaaccactttgcagacgctcgctccgggctccggatcgacaaagacggcctattt
atgggcctatgccagggatga

DBGET integrated database retrieval system