KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8233Help
Entry
blr8233           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_3 HTH_23 HTH_32 HTH_28 HTH_29 HTH_Tnp_1 LZ_Tnp_IS481 Terminase_5
Motif
Other DBs
NCBI-GeneID: 1048227
NCBI-ProteinID: NP_774873
RhizoBase: blr8233
UniProt: Q89BC3
Position
9024866..9026317
Genome map
AA seq 483 aa AA seqDB search
MIPEAREVHLSRKDRKVLEACCRSPVTLQRDLKRARIVLLAADGRSTRSIAKEVGVQPRI
VSLWRHRYADHGLEGLQDKPRPGKQPIYTKTTDKRILKLLDKPPPQGFARWTGPLLAEAL
GDVDVQYVWRFLRSHKIDLVARKSWCESNDPNFTAKAADVVGLYVAPPAKAIVLCVDEKP
SIQALERAQGYLKLPNGRALTGQSHDYKRHGTTTLFAALEVATGKIIATHSKRRRRVEFL
DFMNSVTAAFPNRKLHVILDNLNTHKKNEDWLKAHPNVQFHFTPTSASWLNQVEVWFSLA
GAVAQRHLLHEPQAASGTHRCLRQRIQRQSRALRLDQEKGPSTPFQRPPYHSALIPGTRR
IARRGEHLRALSPRRHCRLDLLRLVQGVSRGRQAPPGRRHGTSCDLRRGEGPPPGGRRLE
GGRRRSDAGEPSAQKKYERRWGGRGMRYPASEKAEIHPFGRAIAPPAKRTLDKLGIPRAT
FYR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatacccgaagcaagagaagtccacctttcgaggaaagatcgcaaggtgcttgaggcg
tgctgtcgctcaccggtgacgttgcagcgcgatttgaagcgggcgcggatagttctgttg
gcggcggatgggcgcagcacccggtcgatcgccaaggaagttggggtccagccgcggatt
gtcagcctttggcggcatcgctatgccgaccatggccttgaagggctgcaagacaagccg
cggcctggcaagcagccgatctatacgaagacgaccgacaagcggattctgaagctgctg
gataagccgccaccgcaagggtttgcgcgctggaccggccccctgctggccgaggcgctg
ggcgatgtcgatgtccaatatgtctggcggttcctgcgcagccacaagattgacctggtg
gctcgcaagtcctggtgcgagagcaacgacccgaactttacggccaaagccgccgatgtt
gtcggcctctatgtcgcgccgccggcgaaggccattgtgctgtgcgtggacgagaagccc
tcgatccaggctttggagcgagcgcagggttatctgaagttgcccaatggccgcgccttg
accggccaaagccacgattacaagcggcatggcaccacaacattgtttgcggcgctcgaa
gtcgccaccggaaagatcatcgcgacccattcaaaacgccggcgccgcgtcgagtttctc
gatttcatgaacagcgtcaccgcggcttttccgaaccgcaagcttcacgtcatcctcgac
aacctcaacacccataaaaagaacgaggactggctcaaggcccaccccaacgtgcaattt
catttcacgccgacaagtgcgtcatggctcaatcaggtcgaagtatggttttcccttgca
ggggcagtcgctcagcggcacctccttcacgagcctcaagcagcttcaggaacacatcga
tgcctacgtcaacgcatacaacgacagagccgagcccttcgtctggaccaagaaaaaggt
ccgtcaacgccgtttcaaaggccgccgtatcactcagctctgattccgggtactagaagg
attgcgcggcgaggagaacatctccgagctttgtcgccgagaaggcattgccgcctcgat
ctattacggctggtccaaggagtttctcgaggccggcaagcgccgcctggccggcgacac
ggcacgagctgcgacctccggcgaggtgaaggacctccgccgggaggccggcgccttgaa
ggaggccgtcgccgatctgacgctggagaaccgtctgctcaaaaaaagtatgaacggaga
tggggaggacgaggcatgaggtatcccgcctcagagaaggccgagattcatccatttggt
cgagcaatcgcacctccggccaagcgcacgctggacaagctcgggatcccgcgcgccaca
ttctatcgctag

DBGET integrated database retrieval system