KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8235Help
Entry
blr8235           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 HTH_28 HTH_Tnp_ISL3 HTH_23
Motif
Other DBs
NCBI-GeneID: 1048248
NCBI-ProteinID: NP_774875
RhizoBase: blr8235
UniProt: Q79V32
Position
9027176..9027535
Genome map
AA seq 119 aa AA seqDB search
MDFLPDSGEDSCCESGAKMTKKSRRTHSPAFKAKVALAAVKGDKTLAELAQLFDVHPNQI
TIWKNQLLEGAAGVFGHDKTSAETPVDLKALHAKIGELALENDFLSGALTKAGLLSAKR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtggattttctgcctgacagcggcgaggattcttgctgcgaatcaggagcgaagatgacg
aagaagagccgccggacgcattctccggcattcaaggcgaaggttgctttggctgcggtc
aaaggagacaagacactggcggagctggcgcaactgtttgatgttcatccgaaccagatc
acgatctggaaaaaccagctcctggaaggcgccgccggcgtgtttgggcatgacaagaca
tcggccgagacgccggtcgatttgaaggcgttacatgccaagatcggcgagctggcgttg
gaaaacgattttttgtccggcgcgctcaccaaggcgggcctgctgagcgcaaagcgatga

DBGET integrated database retrieval system