KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8236Help
Entry
blr8236           CDS       T00109                                 

Definition
(RefSeq) transposase
  KO
K07497  putative transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    blr8236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_3 HTH_21 DDE_Tnp_IS240 rve_2
Motif
Other DBs
NCBI-GeneID: 1048213
NCBI-ProteinID: NP_774876
RhizoBase: blr8236
UniProt: Q79V31
Position
9027532..9028359
Genome map
AA seq 275 aa AA seqDB search
MIDRGHDLSIVRQAKVLKLARSTVYYEPRPVSAEDLALMRRLDELHLDYPFAGARMLRSL
LRREGVYAGRRHIATLMKRMGIEAVYRRPNTSKPAPGHKIYPYLLRGLKIERPDHAWAMD
ITYIPMRRGFVYLAAVVDVFSRRVLAHRVSITMEAAFCVQAVQEALAKHGRPEIFNTDQG
SQFTSLEFTDVLLDAKIAISMDGKGAWRDNVFVERLWRTVKYEEVYLRAYDSVSEARASI
AKYLAFYNQGRPHSSLDGRTPDEAYFGTQAMVMAA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccgcggtcatgatctttctatcgtgcgccaggcgaaggtcctgaagctggct
cgcagcacggtctactatgaacctcggccagtttcggccgaggaccttgccttgatgcgt
cggctcgatgagctgcatctcgattatcccttcgcgggagcgcgtatgctgcgatcgttg
ctgcggcgggagggggtatacgccggtcgccgccacatcgcgacgctgatgaagcgcatg
gggatcgaggcggtctatcgtcgcccgaacacgagcaagccggctccgggtcacaagatc
tacccgtacctgttgcgcggattgaagatcgagcggcccgaccatgcgtgggcaatggac
atcacctacattccgatgcggcgtggcttcgtctatctcgcggcggtcgtcgatgtgttc
agccgacgggtcctggcccatcgcgtctcgatcacaatggaggcggccttctgcgtccaa
gcggtccaggaggcgttggcgaagcacggcagacccgagattttcaacacggatcagggc
agccagttcaccagcctcgagttcaccgatgtgctgctggacgcgaagatcgccatcagc
atggacggcaagggcgcctggcgcgacaacgtgtttgtcgagcggctctggcgcacggtc
aaatacgaagaagtttatctccgcgcctacgacagcgtgtccgaggcgcgagcgtcaatt
gccaagtatctggccttctacaatcagggacgccctcactcgagccttgacgggcgcacg
cccgacgaggcttacttcggcacgcaagctatggtgatggccgcatga

DBGET integrated database retrieval system