KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8240Help
Entry
blr8240           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prok-TraM
Motif
Other DBs
NCBI-GeneID: 1048225
NCBI-ProteinID: NP_774880
RhizoBase: blr8240
UniProt: Q877N2
Position
9029671..9030015
Genome map
AA seq 114 aa AA seqDB search
MSDEPDLESRVVAAIRHYRAALDVAENLEREDACAHRALTSTLLDLERALRGEAAPHLNN
NLFETGSTAVARSDKTWADLVEATARLDSARRTLAALERQLGYLPKVSRGADHK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgagcccgacctcgagagcagagtcgttgcagcgatacgacactatcgtgcg
gcgctcgacgtggcggaaaacctggaacgagaggacgcgtgcgcgcatcgagcgctgacg
agcaccctgctcgatttggagcgtgccctgcgaggcgaagcggccccgcatctcaacaac
aacctgtttgagaccggctccacggcggttgcacggtcggataaaacatgggccgacctg
gtcgaggcgactgcgagattggattcggcccgtcgaaccttagctgctctggaacggcag
ttgggatatcttccaaaagtctcgaggggagcggatcacaagtga

DBGET integrated database retrieval system