KEGG   Bradyrhizobium diazoefficiens USDA 110: bsl2575Help
Entry
bsl2575           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1050154
NCBI-ProteinID: NP_769215
RhizoBase: bsl2575
UniProt: Q89S30
Position
complement(2816486..2816746)
Genome map
AA seq 86 aa AA seqDB search
MQPTSRFEATIPTQLHALISDLRWRAQLLDADILEEERKAGISDPKNLAYPILAQNLRAR
RDNLQVSIAILESRIEKRSTDWPHAA
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgacgtcccgtttcgaagcgactatcccgacacagctccacgccctgatctcc
gatctgcgttggcgcgcgcaattgctcgacgccgacattctggaggaagagcggaaggcc
ggaatctccgatccaaagaatctcgcctacccgatactcgcgcagaacctgagagcccgg
cgcgacaacctccaggtgagcatcgcgatcctggaaagccgcattgaaaagcgatcaacc
gactggccgcacgccgcctga

DBGET integrated database retrieval system