KEGG   Bradyrhizobium diazoefficiens USDA 110: bsl8242Help
Entry
bsl8242           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS240
Motif
Other DBs
NCBI-GeneID: 1048229
NCBI-ProteinID: NP_774882
RhizoBase: bsl8242
UniProt: Q877S0
Position
complement(9031686..9031862)
Genome map
AA seq 58 aa AA seqDB search
MKKLLKSAGTPPRVMITDKRSHGAARAKMGFFVEHRQHRALNNRAENSHQPTRQRGGS
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctcttgaaatccgccggcacgccgccgcgcgtgatgatcacggacaagcgt
tcgcacggcgctgcgagggcgaagatgggctttttcgtcgaacatcgccagcacagagct
ctcaacaatcgggctgagaattctcatcagccgacgcggcaacgcggcggatcatga

DBGET integrated database retrieval system