KEGG   Bradyrhizobium diazoefficiens USDA 110: bsl8249Help
Entry
bsl8249           CDS       T00109                                 

Gene name
cspA
Definition
(RefSeq) cold shock protein
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bja03000]
    bsl8249 (cspA)
Transcription factors [BR:bja03000]
 Prokaryotic Type
  Other transcription factors
   Others
    bsl8249 (cspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB Rho_RNA_bind
Motif
Other DBs
NCBI-GeneID: 1048179
NCBI-ProteinID: NP_774889
RhizoBase: bsl8249
UniProt: Q89BB3
Position
complement(9042146..9042349)
Genome map
AA seq 67 aa AA seqDB search
MAIGTVKWFNPTKGYGFIQPDSGGNDVFVHISAVEKAGFTSLAEGAKVSFDIVKNRGKES
AENLRIE
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattgggacagtgaagtggttcaacccaacaaaggggtatgggttcattcaaccg
gattccggcggcaatgacgtctttgtccacatctccgcggttgagaaggctggttttact
tcgctcgcagagggcgcaaaagtcagcttcgacatcgtgaaaaatcgcggaaaggagtcg
gcggaaaatctacgaatcgagtga

DBGET integrated database retrieval system