KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr8214Help
Entry
bsr8214           CDS       T00109                                 

Definition
(RefSeq) transposase
  KO
K07483  transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    bsr8214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 HTH_28 Cas_Cas1 TSC22
Motif
Other DBs
NCBI-GeneID: 1048281
NCBI-ProteinID: NP_774854
RhizoBase: bsr8214
UniProt: Q89BE1
Position
9012099..9012509
Genome map
AA seq 136 aa AA seqDB search
MRREDFWFIVATRSEDEAEIRTGQSAAEQVLKDILRQTRRHYSSEEKIRIVLEGLRGEEN
ISELCRREGIAASMYYGWSKEFLEAGKRRLAGDTARAATSGEVKDLRRETVALKEAVADL
TLENRLLKNSMNGLYR
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
ttgcggagggaggatttctggttcatcgtagccaccaggagcgaagatgaagcagaaatc
cgtaccgggcaaagtgccgcagaacaagttctaaaagacattctgcgacaaacccgccgg
cattattcgtcggaggagaagatccgcattgtgctggaaggattgcgcggcgaggaaaat
atctccgagctctgtcgccgcgagggcattgccgcctcgatgtattacggctggtccaag
gagttcctcgaggccggcaagcgccgcctggcgggcgacacggcacgagctgcgacctcc
ggcgaggtgaaggatctccgccgggagactgttgccctgaaggaggccgtagccgatctg
accctggagaaccgtctgctcaaaaatagcatgaacgggctctataggtga

DBGET integrated database retrieval system