KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr8263Help
Entry
bsr8263           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1048149
NCBI-ProteinID: NP_774903
RhizoBase: bsr8263
UniProt: Q89BA1
Position
9053385..9053621
Genome map
AA seq 78 aa AA seqDB search
MQRSGSSQFREFGVFDAEMTALLRAVLDEVCENIPVSETGARAYVASKLLDAAAHGQLST
DALKAAGRKALNPPTMWR
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgttcaggatcctctcaatttcgggagttcggcgtgtttgatgctgaaatgact
gcgctgctcagggcggtgctcgacgaagtttgcgaaaatattcctgtaagcgaaacgggc
gccagagcgtacgttgcttcgaagctgctcgatgctgcggcacatggacagctctcaacc
gacgcgttgaaagcggcgggtcgcaaggccttgaacccaccaacgatgtggcgctga

DBGET integrated database retrieval system