KEGG   Bradyrhizobium japonicum E109: RN69_10870Help
Entry
RN69_10870        CDS       T03509                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00030  Pentose phosphate pathway
bjp01100  Metabolic pathways
bjp01120  Microbial metabolism in diverse environments
bjp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RN69_10870
Enzymes [BR:bjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     RN69_10870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Epimerase
Motif
Other DBs
NCBI-ProteinID: AJA60828
Position
2315004..2315840
Genome map
AA seq 278 aa AA seqDB search
MPQTDRSTPFSSRLVGQYALVTGASQGIGRAVAIRLAQEGATVAINYVDHPERAEETLAL
ARTGSADRGHGKLDHVVVKADVSNEREVGAMFETVLSRWKRLDCLVNNAGFQRESPSEAL
DIETYRRIIDVNLNGAVLCAQKALAHFVARGGGGSIINCSSVHQIIPKPGYLAYSISKGG
IANLTRTLALEFAGRGIRVNAVGPGAIDTPINAAWTGDPAKRGVVTSHIPLERVGTPEEI
AAVFAFLASDDASYITGQTIYACGGLTLFPEFRENWAS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaccgatcgctcgaccccgttttcctcccgcctcgtcggccaatacgcgctg
gtgaccggcgcctcgcaaggcatcggccgcgccgtcgccatccggctcgcgcaggagggc
gcgaccgtcgccatcaattatgtcgatcaccccgagagggccgaggagacgctcgcgctc
gcaaggacaggatcggctgatcgcggccacggcaagctcgaccatgtcgtcgtcaaggcc
gatgtcagcaatgagcgggaggtcggtgcgatgttcgagacggtgctttcgcgctggaag
cggctcgactgccttgtcaacaatgccggcttccagcgggagtcgccgagcgaggcgctc
gacatcgagacctaccgccgcatcatcgacgtcaatctcaacggcgccgtgctctgcgcg
cagaaggcgctcgcccacttcgtcgcgcgcggcggaggcggcagcatcatcaactgctcc
agcgtccaccagatcattccgaagcccggctatctcgcttattcgatcagcaagggtggc
atcgccaatctgacgcgcacgctggcgctggaattcgccggccgcggcattcgtgtcaat
gcggtaggtcccggcgcaatcgacacgccgatcaacgcggcgtggacgggtgatcccgcc
aagcgcggcgtcgtcaccagccacattccgctggaacgggtcggcacgccggaagagatt
gccgccgtgttcgccttcctcgcctcggatgacgccagctacatcacaggccagaccatt
tacgcctgcggaggcctgacgctgttccccgagtttcgggagaattgggcgagctag

DBGET integrated database retrieval system