KEGG   Bradyrhizobium japonicum E109: RN69_18360Help
Entry
RN69_18360        CDS       T03509                                 

Definition
(GenBank) UDP-glucuronate 5-epimerase
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00520  Amino sugar and nucleotide sugar metabolism
bjp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RN69_18360
Enzymes [BR:bjp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     RN69_18360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short NAD_binding_10 NAD_binding_4 KR adh_short_C2 NmrA
Motif
Other DBs
NCBI-ProteinID: AJA62083
Position
3915399..3916388
Genome map
AA seq 329 aa AA seqDB search
MTDQAILVTGAAGFIGFHVARQLLAEGRPVVGLDNLNSYYDPALKQARLALLRNDSNFAF
VEADLADRETIAALFARHRFDKVVHLAAQAGVRYSIDHPHAYADSNLQGFLNVLEGCRNN
SCRHLVYASSSSVYGANTKLPFAVQDRTDHPVSFYAATKKANELMAQSYSHLYRLPVTGL
RFFTIYGPWGRPDMALFLFVNAIMAERPIRLFNHGKMRRDFTYIDDVTRVVSKLIDRVPA
DDPAAANAPSKVYNVGNHHPEELMHVVGLLEQELGRTAIKELLPMQPGDVLETFADVEDL
TRDTGFAPSTPIALGVRNFVTWYRDYFKV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcaggcgattttggtcacgggagccgccgggttcatcggctttcacgtcgcc
cggcagctcctggccgagggccggcccgtggtcgggctcgacaatctcaacagctattac
gatccggcgctgaaacaggcgcgcctggcgctgcttcggaacgattccaacttcgccttc
gtcgaggccgatcttgccgaccgcgagaccatcgcggcgctgtttgcgcgacatcgattt
gacaaagtcgtgcatctcgcggcgcaggcgggcgtgcgctactcgatcgaccatccgcac
gcttacgccgattccaacctccagggctttctcaacgtcctggagggctgccgcaacaac
tcttgtcgtcatctcgtctacgcctcgtcatcctccgtttatggcgccaacactaaactg
ccatttgccgtgcaggaccggaccgaccatcccgtgagcttctatgccgcgaccaagaag
gcgaacgaattgatggcgcagtcctacagccatctctaccggctgccggtcacgggcctg
cgcttcttcaccatctacggcccgtggggccgacccgatatggccctgtttctgttcgtg
aacgccatcatggctgagcgtccgatccggctctttaaccatggcaaaatgcgtcgcgac
ttcacctatattgacgacgtcacccgtgtagtatccaagctcatcgatcgggtgcccgcg
gatgacccggctgccgcaaatgcgccgtctaaggtctacaatgtcggcaaccaccatccg
gaagagctgatgcatgtcgtcgggcttctggagcaggagctgggtcggacggcaatcaaa
gaattgctgccgatgcagccgggagacgtcttggaaacgttcgcggatgtcgaggatctg
acgcgcgacaccggctttgcaccgtcaacgccgatcgcgctcggggtccgtaattttgtc
acctggtatcgggactacttcaaggtttga

DBGET integrated database retrieval system