KEGG   Bradyrhizobium japonicum E109: RN69_18365Help
Entry
RN69_18365        CDS       T03509                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00051  Fructose and mannose metabolism
bjp00520  Amino sugar and nucleotide sugar metabolism
bjp01100  Metabolic pathways
bjp01110  Biosynthesis of secondary metabolites
bjp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RN69_18365 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    RN69_18365 (cpsB)
Enzymes [BR:bjp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     RN69_18365 (cpsB)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     RN69_18365 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 Cupin_1
Motif
Other DBs
NCBI-ProteinID: AJA66694
Position
3916396..3917808
Genome map
AA seq 470 aa AA seqDB search
MDKRIIPLIMCGGAGTRLWPASREVRPKQFLPLFGTRSTFQDTLLRVSDASLFDRPIVIT
NASYRFMVLEQLAEIGIEADVILEPMRRDSGPAIAAGAVFAQNRAGDAIVLALAADHVVQ
DNAAFVAACREGLTAASAGRIVTFGVKPERPATEYGYISPGEVISGEVHAVARFVEKPDA
VKAADYVSSGYLWNSGNFMFPATVLLDEYRKVDAASVEAVSNAVANAGRDLGFVTLEPEA
FGAAKAISIDYAVMEKTSRAAVVPVSCGWSDVGSWRAVWELSEKDTQGNSAHGTAVFEDS
RNCNVTSDHALVALEGVDDLVVVATADAVLVSRQKDANGLKRLVTKLKAVAPKVTEEHLK
VHRPWGSYQSVDNGERHQVKRIVVKPGGRLSLQKHHHRAEHWIVVRGAARVTVNETVKTV
HENESIYIPMGAVHRMENPGKIMLELIEVQTGSYLGEDDIIRIEDDYQRS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacgcattatccccctgatcatgtgcggcggtgccggcacgcggctgtggccg
gcttcgcgcgaggtgcgccccaaacagttcctgccgctgttcggcacgcgctcgaccttc
caggacacgctgctgcgcgtgtcggatgcctcgctgttcgatcgtccgatcgtcatcacc
aatgcgtcctatcgcttcatggtgctggagcagcttgccgagatcggcatcgaggccgac
gtgatcctcgagccgatgcggcgcgattccggccccgcgatcgccgcgggcgcggtgttc
gcgcagaaccgcgccggtgacgcgatcgtgctcgcgctcgccgccgaccacgtggtgcag
gacaatgcggccttcgtcgccgcctgccgcgagggcctcaccgccgcgagcgccgggcgc
atcgtcaccttcggcgtcaagccggaacggccggcgaccgaatacggctatatcagcccg
ggcgaggtgatctccggcgaggtgcatgccgtcgcgcgcttcgtcgaaaagcctgatgcc
gtgaaggcggccgactacgtcagctcgggttatctctggaacagcggcaacttcatgttc
ccggccacggtcctgctcgacgagtaccgcaaggtggatgcggcgagcgtcgaggcggtg
tccaatgcagtggccaatgccggccgcgatctcggcttcgtgacgctggagcccgaggcg
ttcggcgcggcgaaggcgatctcgatcgactacgcggtgatggagaagacctcgcgcgca
gcggtcgtgccggtgtcctgcggctggtccgacgtcggctcctggcgcgccgtgtgggaa
ttgtccgagaaggacacgcaaggcaactcggcacacggcaccgccgtgttcgaggattcg
cgcaactgcaacgtcacgagcgatcatgcgctggtcgcgcttgaaggcgtcgacgatctc
gtcgtggtcgccaccgcggatgcggtgctggtctcgcgccagaaggatgccaacggcctg
aagcgcctggtgacgaagctgaaggcggtcgcgccgaaggtcactgaggagcatctcaag
gtgcaccggccctggggcagctaccagtccgtcgacaacggcgagcgccatcaggtcaag
cgcatcgtggtgaagccgggcgggcggctgtcgctgcagaagcaccatcatcgtgccgag
cactggatcgtcgttcgcggcgcggcccgggtgaccgtcaacgagaccgtcaagaccgtg
cacgagaacgaatccatctacatcccgatgggcgcggtgcaccggatggagaaccccggt
aaaatcatgctggaactcatcgaggtccagaccggcagctatctcggggaagacgacatc
atccggattgaagacgactatcaaaggtcgtaa

DBGET integrated database retrieval system