KEGG   Bradyrhizobium japonicum E109: RN69_25400Help
Entry
RN69_25400        CDS       T03509                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00450  Selenocompound metabolism
bjp00970  Aminoacyl-tRNA biosynthesis
bjp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RN69_25400
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RN69_25400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bjp01007]
    RN69_25400
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bjp03016]
    RN69_25400
Enzymes [BR:bjp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RN69_25400
Amino acid related enzymes [BR:bjp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RN69_25400
Transfer RNA biogenesis [BR:bjp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RN69_25400
 Prokaryotic type
   Other AARSs
    RN69_25400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AJA66834
Position
5341736..5343259
Genome map
AA seq 507 aa AA seqDB search
MSTAIAYPNGSPHIGHAYEAISADVLARFARLDGKDVFFLTGTDEHGQKMVQTAQNEGLT
PSALATRNAGRFKEMDERLNVSFDRFIRTTEEQHHRSSQEIWRRMEANGDIYADTYAGWY
SVRDEAYYAEDETRLNDDGVRLGPQGTPVEWVEEKSYFFRLSAYQDKLLKLYEDHPEFIG
PDSRKNEVVSFVRGGLRDLSISRTTFDWGVKVPSDEEHVMYVWVDALTNYITGVGFPDES
DENWRYWPADVHIIGKDIIRFHAVYWPAFLMSAGISLPKRVYAHGFLFNRGEKMSKSVGN
VVDPFNLADQYGVDQMRYFFLREVSYGQDGNYNHEAIVARINADLANDLGNLAQRSLSMI
AKQLGGVLPEPGEFSDNDKAILAMADGMIAASREAMATQQIHHWLNAVWAVVAEANRYFA
GEAPWALAKTDPVRQKTVLYVTAEVVRQIAILAQPAMPTASGLLLDSLGIPAGERNFAML
GGAKRIAPGSTLPAPTPAFPRYIEPAA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atctcgaccgccatcgcctatcccaacggcagcccgcatatcggccacgcctatgaggcg
atctcggccgacgtgctggcgcgctttgcgcggctcgacgggaaggacgtgttcttcctg
accggcaccgacgagcatggtcagaagatggtccagaccgcgcagaacgagggcctgacc
ccgtccgcgctcgcgacccgcaatgctggccgcttcaaggagatggacgagcgtctgaac
gtgtcgttcgaccgcttcatccgcaccaccgaagagcagcaccatcgctccagccaggaa
atctggcggcgcatggaagcgaacggcgacatctacgccgacacctatgccggctggtac
tcggtgcgcgacgaggcgtattacgccgaggacgagacgcgcctgaacgacgacggcgtg
cgcctcggcccgcaaggcacgccagtcgaatgggtcgaggagaagagctatttcttccgc
ctgtcggcctatcaggacaagcttctgaagctctacgaagatcatcccgaattcattggc
ccggactcgcgcaagaacgaggtggtgagcttcgtgcgcggcggcctgcgcgatctctcg
atctcgcgcacgaccttcgattggggcgtgaaagtgcccagcgacgaagagcacgtgatg
tatgtctgggtcgacgcgctgaccaattacatcaccggcgtcggattccccgacgagagc
gacgagaactggcgctactggccggccgacgtgcacatcatcggcaaggatatcatccgc
ttccacgcggtctactggcccgcattcctgatgtcggccggcatttcgctgccgaagagg
gtctatgcccatggcttcctgttcaacaggggcgagaagatgtcgaagtcggtcggcaat
gtcgtcgaccccttcaatcttgccgaccagtatggcgtcgaccagatgcgctatttcttc
ctgcgcgaggtctcgtatggccaggacggcaactacaaccacgaagccatcgtcgcgcgc
atcaatgccgatctcgccaacgacctcggcaacctcgcgcagcgctcgctgtcgatgatc
gccaagcagctcggcggcgtgctgccggagccgggcgagttcagcgacaacgacaaggcg
attttggcgatggcggacggcatgatcgccgcatcgcgcgaagcgatggcgacgcagcag
atccatcactggctcaacgcggtgtgggccgtggtcgcggaggccaaccgttatttcgcg
ggcgaggcgccgtgggcgctcgctaagaccgatcctgtcaggcagaagacggtgctctat
gtcaccgccgaagtcgtgcgccagatcgcgatcctggcccagccggcgatgccgaccgcc
tcgggcctgctgctcgacagcctcggcattcccgcgggcgagcggaatttcgcgatgctc
gggggcgccaaacggatcgcgccaggctcgacgctgccggcgccgacaccggcgttcccg
cgctacatcgagccggcggcctag

DBGET integrated database retrieval system