KEGG   Bacillus sp. JS: MY9_0121Help
Entry
MY9_0121          CDS       T02027                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bjs  Bacillus sp. JS
Pathway
bjs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MY9_0121
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bjs03011]
    MY9_0121
Ribosome [BR:bjs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MY9_0121
  Bacteria
    MY9_0121
  Archaea
    MY9_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFI26661
UniProt: I0EZK5
Position
138554..138895
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEH
NYEMDVNNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaacagtccgtattgctcctcgtaaagcacgtctagta
atggacctgattcgaggcaagcaagtaggtgaggcagtatcaatcttgaaccttacacca
agagctgcttctccaattatcgagaaagtattaaaatccgctattgcaaatgctgagcat
aactatgaaatggacgttaacaacctggttatttctcaagcattcgttgacgaaggccct
acgttaaaaagattccgcccacgtgctatgggacgtgcgagccaaatcaacaaacgtacg
agccacattacaatcgttgtatcagaaaagaaggagggataa

DBGET integrated database retrieval system