KEGG   Bacillus sp. JS: MY9_0440Help
Entry
MY9_0440          CDS       T02027                                 

Definition
(GenBank) putative ribosomal protein N-acetyltransferase
  KO
K03817  ribosomal-protein-serine acetyltransferase [EC:2.3.1.-]
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bjs03009]
    MY9_0440
Enzymes [BR:bjs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     MY9_0440
Ribosome biogenesis [BR:bjs03009]
 Prokaryotic type
  ribosomal protein modification factors
   MY9_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_4 Acetyltransf_1 Acetyltransf_8
Motif
Other DBs
NCBI-ProteinID: AFI26979
UniProt: I0F0H3
Position
468631..469176
Genome map
AA seq 181 aa AA seqDB search
MFTCKVNEHITIRLLEPKDAERLAELIIENQQRLGKWLFWAENPSSAETYRETIIPNWRW
EYADLTSIEAGLLYDGSLCGMIGLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITY
AFEELELNRVAICAAVGNEKSRAVPERLGFLEEGRARDGLFVNGRHHDLIYYSLLKHEWK
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgttcacttgcaaggtaaatgagcacatcaccatccgattattggagccgaaggatgcg
gagcggctggccgaactcattatcgaaaatcagcagcggcttggcaagtggctgttttgg
gcggaaaatccaagcagcgctgaaacgtacagagaaacgatcattccaaattggcggtgg
gaatatgctgatctgaccagcattgaggcggggctcctttatgacggcagcctatgcggc
atgatcggactgcataaccttgatcaagtgaatcggaaagcggaaatcggatactggatt
gccaaagaatttgaagggaaaggcattattaccgctgcctgccgaaaactcattacttat
gcttttgaagagcttgagctgaatcgtgtggcgatctgtgcggctgtcggaaacgaaaaa
agcagagcggttccggagcggctcggctttctagaggaaggaagggcacgggacggctta
ttcgtaaacggcaggcaccatgatcttatctattacagcttgctaaagcatgaatggaaa
ggatga

DBGET integrated database retrieval system