KEGG   Bacillus sp. JS: MY9_1406Help
Entry
MY9_1406          CDS       T02027                                 

Definition
(GenBank) Phosphate transporter family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MY9_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AFI27943
UniProt: I0F387
Position
complement(1398367..1399368)
Genome map
AA seq 333 aa AA seqDB search
MDILFILTILIVICALAFDFINGFHDTANAIATSVSTKALKPRHAIIMAAVMNFIGAMTF
TGVAKTITKDIVDPYTLENGSVVILAALVAAIAWNLITWYYGIPSSSSHAIIGAIAGAAV
AAAGFTALNYKGFIKIIEALIFSPIIAFVLGFILYSIVKLIFKDSNLAKTNKQFRRVQIV
TAALQSYTHGTNDAQKAMGIITMALITANLHTSSNDIPTWVQFACATAMGLGTSIGGWKI
IKTVGGKIMKIRPVNGVSADLTGAAIIFGATFIHLPVSTTHVISSSILGVGASHRVKGVN
WGTAKRMLITWVITLPISATLGAIAYFILNMIF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggatattctattcatattaacaatactaatagtcatttgtgctctggcgtttgatttc
atcaatgggtttcatgatacggcgaacgctattgcgacttcggtatcaactaaagcgctg
aaaccgcgccatgccattatcatggcggctgtgatgaattttatcggagcaatgacattt
acaggtgttgccaaaaccattacgaaagacattgtagatccttatactctggaaaatggc
tctgtcgtaattctggccgcgctagtcgctgcgattgcctggaaccttatcacatggtac
tacggcatcccaagcagctcgtcccatgccatcattggagctattgccggagcagccgtt
gcggcagccggatttactgcgttaaattataaaggcttcattaaaatcattgaagcattg
atcttttcaccgattatcgcttttgtccttggttttattttatacagtatcgtcaagctg
attttcaaagacagcaatttggcgaaaacaaacaagcaattccgcagagtgcagattgta
acagctgccctgcaatcgtatacgcacggaacaaacgatgcgcaaaaagcaatgggaatt
atcacaatggctctcatcacagcgaatttacatacttcttctaacgatattcctacctgg
gtgcaattcgcctgcgcgacagccatgggtctaggaacatcaatcggcggctggaaaatc
atcaaaaccgttggcggaaagatcatgaaaattcgcccggtaaacggggtttccgctgac
ttaaccggggcagccattattttcggcgctacatttattcatttgccggtcagtacaacc
cacgtcatttcttcatcaattcttggcgtcggtgcgtcacaccgagtaaaaggcgtaaac
tggggtacggccaagcgaatgctcattacatgggtcattacgcttccgatttcagcgaca
cttggtgccatcgcctactttattttaaatatgattttttaa

DBGET integrated database retrieval system