KEGG   Bacillus sp. JS: MY9_1692Help
Entry
MY9_1692          CDS       T02027                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bjs03009]
    MY9_1692
Enzymes [BR:bjs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     MY9_1692
Ribosome biogenesis [BR:bjs03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MY9_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Poly_export ThiS-like Ub-Mut7C DUF3892 DUF4981 S4_2
Motif
Other DBs
NCBI-ProteinID: AFI28229
UniProt: I0F423
Position
1663560..1664471
Genome map
AA seq 303 aa AA seqDB search
MNQIDITASEEQKSERIDKFLASTENDWSRTQVQQWVKDGQVVVNGSAVKANYKIQPGDQ
VTVTVPEPEALDVLAEPMDLDIYYEDQDVLVVNKPRGMVVHPAPGHLTGTLVNGLMAHCT
DLSGINGVMRPGIVHRIDKDTSGLLMVAKNDMAHESLVNQLVNKTVTRKYTAVVHGLISH
DDGTIDAPIGRDKKDRQSMTVTRDGKNAVTHFHVLERFQDFTLVECQLETGRTHQIRVHM
KYIGFPLAGDPKYGPRKTIDFNGQALHAGVLGFDHPRTGEYVEFEAPLPDDMAELIETLR
KNG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaattgatataaccgcttcagaagaacaaaaaagtgagcggattgataaattt
ttggcatcaactgagaatgattggtcaagaacccaggttcagcaatgggtaaaagacgga
caggttgtcgtgaacgggagtgcggtgaaagcgaattataaaattcagccgggtgatcag
gtgaccgtcactgtacccgaaccggaagcgctcgacgtcctggcagaacctatggatctt
gatatttattatgaagatcaggatgtgctggttgtcaataagcctcgcggaatggttgta
cacccagcacccggtcatcttacgggcacacttgtaaacggccttatggctcattgtaca
gacctttccggaataaatggtgtgatgcgtccggggattgttcacagaatcgataaggac
acgtccggcttattaatggtggcgaaaaatgatatggcacacgagtcacttgtaaaccaa
ttggtcaacaaaacggtcacgcgaaagtatacggctgttgtccacgggcttatttctcat
gatgacggcacaattgacgcgccgatcgggcgggataaaaaagaccgtcaaagcatgact
gtgacacgtgatggcaaaaacgctgtcactcattttcatgtgcttgagcgttttcaggac
tttacgttagtggaatgccagcttgaaacagggagaacccatcaaattcgtgttcatatg
aaatatatcggattcccattagcgggcgacccgaaatatggtccgagaaaaacaatcgac
tttaacggccaggcgcttcacgcgggcgttttaggttttgaccacccgcgaacaggagaa
tatgtcgaatttgaagcgccgcttcctgatgatatggcagaattaatcgaaaccctcaga
aaaaacggttga

DBGET integrated database retrieval system