KEGG   Bacillus sp. JS: MY9_1755Help
Entry
MY9_1755          CDS       T02027                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00020  Citrate cycle (TCA cycle)
bjs00640  Propanoate metabolism
bjs00660  C5-Branched dibasic acid metabolism
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
bjs01130  Biosynthesis of antibiotics
bjs01200  Carbon metabolism
Module
bjs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bjs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MY9_1755
   00640 Propanoate metabolism
    MY9_1755
   00660 C5-Branched dibasic acid metabolism
    MY9_1755
Enzymes [BR:bjs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MY9_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFI28292
UniProt: I0F486
Position
1727060..1728217
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVESAKSLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagagtgcaaagagcttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcattagacgaagtaaaagcgtatgccgaagaactattagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatattacgtgggtcttgtgcttgaccgcgctacttccaga
atcgttctgatggcttctgaagaaggcggaacggaaattgaagaagttgcggagaaaaca
ccggaaaaaatcaaaaaagctgtcattgatccggctgtcggccttcaaggctatcaagcc
agagaaattgcattcgctattaatattccaaaagagcttgtggggaaagctgctaaattt
atgcttggactatataaagcgtttgttgaaaaagactgctcaatcgccgaaatcaacccg
cttgttgttaccggggacggaaatgtgatggcgcttgatgcaaaattgaattttgacagc
aatgcgttgtacagacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaatcgaagcgtccaaatatgacctaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggacttgcaatgtccacaatggatattatcaagcattacggt
ggagaaccggccaacttccttgatgtgggcggcggtgcaaccgcggaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggatttttgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgactagacaagttggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaacattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttaa

DBGET integrated database retrieval system