KEGG   Bacillus sp. JS: MY9_1985Help
Entry
MY9_1985          CDS       T02027                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00040  Pentose and glucuronate interconversions
bjs00052  Galactose metabolism
bjs00500  Starch and sucrose metabolism
bjs00520  Amino sugar and nucleotide sugar metabolism
bjs01100  Metabolic pathways
bjs01130  Biosynthesis of antibiotics
Module
bjs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MY9_1985
   00052 Galactose metabolism
    MY9_1985
   00500 Starch and sucrose metabolism
    MY9_1985
   00520 Amino sugar and nucleotide sugar metabolism
    MY9_1985
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MY9_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFI28520
UniProt: I0F4W4
Position
1999183..2000076
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVESGIEDILIITGR
NKRSIEDHFDRSAELEFNLREKGKTETLEEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQ
GHVYEVKDLVEKPSPEEAPSDIAVMGRYVLNSSIFPVLKSIGRGAGNEIQLTDALREVCR
NEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLTYLEGVIKRETKEMLR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggttattcccgcagcgggtttaggaacgagatttttg
ccggcgacaaaggcgcagcctaaagaaatgctcccaatcgtcgacaaaccagcaatccaa
tatattgtagaagaggccgtagagtcaggaattgaagatatactgattattacagggaga
aacaaacgctcgattgaagatcattttgaccgatcggcggaattggaattcaatctgcgg
gaaaaaggcaagacggagacacttgaagaaatgcagcagatcgccgatttggccaacatt
cattacatccgccagaaagaaccgctcggattaggccatgcagtactgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggtgatgatattatggtgtctgaaaca
ccggctcttcggcaattaatggatgtatatgacgtttatggcacagaggttgtcggtgta
cagtcagttctccctgaggatgtcagcaaatatggtattataaatacatcagggtctcaa
gggcatgtgtatgaagtgaaagatttagttgaaaagccttcacctgaagaagcgccttcc
gacatcgccgtaatgggacggtatgtgttgaattcttcgatcttccccgttttgaagtca
attggcagaggcgcgggaaacgaaattcagctcacagatgcgcttcgtgaggtttgccgt
aatgagccgatccatgctcggctgctggaaggaaatcgatatgacattggcgataagctg
ggctgttttaaagcgagcactgaaatcggcttaatgcgtcccgaaatgagatctcagctt
ttgacctatttagaaggtgtaatcaaacgggaaacgaaagaaatgctgcggtaa

DBGET integrated database retrieval system