KEGG   Bacillus sp. JS: MY9_1996Help
Entry
MY9_1996          CDS       T02027                                 

Definition
(GenBank) GNAT family acetyltransferase
  KO
K03790  [ribosomal protein S5]-alanine N-acetyltransferase [EC:2.3.1.267]
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bjs03009]
    MY9_1996
Enzymes [BR:bjs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.267  [ribosomal protein S5]-alanine N-acetyltransferase
     MY9_1996
Ribosome biogenesis [BR:bjs03009]
 Prokaryotic type
  ribosomal protein modification factors
   MY9_1996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFI28531
UniProt: I0F4X5
Position
complement(2010068..2010319)
Genome map
AA seq 83 aa AA seqDB search
MNVEAVFGHFPVLESENLVLSKIEEIHVQDVFSIYDNEKVFDYCGIIPKHNIKTVHNMIT
QTRPTTVRGDQARYMGVSGRFID
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggaagcggtgtttggacattttccagtattggaatctgagaacctagtacta
agtaaaatcgaagagatccatgtacaggacgtgttttcgatctatgataatgaaaaagta
ttcgattactgcggaatcatcccgaaacataacataaaaacagtacataacatgattacc
caaactcgaccgaccacagtacgcggtgatcaagctcggtatatgggggtcagcggtcgg
tttattgattga

DBGET integrated database retrieval system