KEGG   Bacillus sp. JS: MY9_2272Help
Entry
MY9_2272          CDS       T02027                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01130  Biosynthesis of antibiotics
bjs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MY9_2272
Enzymes [BR:bjs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MY9_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFI28805
UniProt: I0F5P9
Position
complement(2280105..2280857)
Genome map
AA seq 250 aa AA seqDB search
MLENIIKQKKEEVKTLVLPVEQPFEKRSFKDALASPNRFIGLIAEVKKASPSKGLIKEDF
VPVRIAKDYEAAKADALSVLTDTPFFQGENSHLSDVKRAVSIPVLRKDFIIDSLQVEESR
RIGADAILLIGEVLDPLHLYELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNR
NLKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQ
RKAIHALFGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaatatcatcaaacaaaagaaagaagaagtgaaaacactggttctgccggta
gagcagcctttcgaaaaacgttcatttaaagatgcgttggcaagcccgaatcggtttatc
ggactgattgccgaagtgaagaaagcatcaccgtcaaaagggctgattaaagaggatttt
gtccctgtgcggattgcaaaagactatgaagctgcgaaggcagatgcgctttccgtttta
acagacaccccgttttttcaaggggaaaacagccatttatcagatgtaaagcgcgctgtt
tcgattcctgtactcagaaaagattttattattgattctcttcaagtggaggaatcaaga
agaatcggtgcggatgccatattgttaatcggcgaggtgcttgaccctttacacctctat
gaattatatcttgaagcaggcgaaaaggggatggacgtgttagtggaggttcatgatgca
tcaacgctagaacaaatattgaaagtgttcacacctgatattctcggcgtaaataaccgt
aacctaaagacgtttgaaacatctgtaaagcagacagaacaaatcgcatctctcgttccg
aaagaatctctgcttgtcagcgaaagcggaatcggttctttagaacatttaacatttgtc
aacgaacatggggcgcgagctgtacttatcggtgaatcattgatgagacaaacttctcag
cgaaaagcaatccatgctttgtttggggagtaa

DBGET integrated database retrieval system