KEGG   Bacillus sp. JS: MY9_2435Help
Entry
MY9_2435          CDS       T02027                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00071  Fatty acid degradation
bjs00072  Synthesis and degradation of ketone bodies
bjs00280  Valine, leucine and isoleucine degradation
bjs00310  Lysine degradation
bjs00362  Benzoate degradation
bjs00380  Tryptophan metabolism
bjs00620  Pyruvate metabolism
bjs00630  Glyoxylate and dicarboxylate metabolism
bjs00640  Propanoate metabolism
bjs00650  Butanoate metabolism
bjs00900  Terpenoid backbone biosynthesis
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
bjs01130  Biosynthesis of antibiotics
bjs01200  Carbon metabolism
bjs01212  Fatty acid metabolism
bjs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MY9_2435
   00630 Glyoxylate and dicarboxylate metabolism
    MY9_2435
   00640 Propanoate metabolism
    MY9_2435
   00650 Butanoate metabolism
    MY9_2435
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MY9_2435
   00072 Synthesis and degradation of ketone bodies
    MY9_2435
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MY9_2435
   00310 Lysine degradation
    MY9_2435
   00380 Tryptophan metabolism
    MY9_2435
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MY9_2435
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MY9_2435
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MY9_2435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bjs04147]
    MY9_2435
Enzymes [BR:bjs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MY9_2435
Exosome [BR:bjs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MY9_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFI28968
UniProt: I0F662
Position
complement(2419350..2420531)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQRAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAIPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKSNVVDKDEAIRRDTSLDQLAKLSPIYTSDG
SITAGNAPGVNDGAGAFVLMSEEKAAELGKQPLATILGFSTMGMPAHELAAAPGFAINKL
LKKNDLTAQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaacgccatttggcaaattcggcggagta
ttgaaagaggtgaaagctgccgagcttgggggcattgtgatgaaggaggcgttgcaacgg
gctggagtctctggagatgatgtagaaggaaatgtcatgggcatggttgtccaagccggc
tcaggacagatcccttcccgtcaagctgcccgtcttgctggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgtgcttcgggtcttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgccggggggatggaaagcatgagcaat
attccgtatgccattcccgctggacgctggggagcacggatgggggacggcgagctaagg
gatttaatggtgtatgacgggttaacgtgcgcatttgacgaagtgcatatggctgttcac
ggaaatacagcggccaaggaatatgcaatttcacgaagagagcaggatgaatgggcgttg
agaagccatgcgcgggcagctaaagcagccgatgaagggaaatttcaggatgaaattgtt
cccgtcaactggatcggtcgaaaaggaaaatcaaacgttgttgataaggatgaagcgatt
cgccgtgacacaagtctggatcagctcgcgaaactttctccgatttatacaagtgatggt
tcgatcacagccggcaatgctcccggggtcaatgacggagctggcgcattcgtgctgatg
tcggaggaaaaagcagctgagcttggcaaacagcctctggctacaattcttggtttttca
actatgggaatgccagcgcatgaactggcggcagcaccggggtttgccattaataagctc
ctgaaaaagaacgatttaactgcccaagatattgacttgtttgaagtaaatgaagcgttt
gcatctgttgtgttaacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgtg
aacggcggtgcgatcgcgcttggccacccgatcggcgcgagcggggcgagaattctcatg
acgctcgtttacgaattaaagcgacggggagggggattgggtgttgccgccatttgcagt
ggggcagcccaaggagatgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system